KEGG   Mycobacterium africanum: MAF_29720Help
Entry
MAF_29720         CDS       T01575                                 

Gene name
pca
Definition
(GenBank) putative pyruvate carboxylase PCA (pyruvic carboxylase)
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
maf  Mycobacterium africanum
Pathway
maf00020  Citrate cycle (TCA cycle)
maf00620  Pyruvate metabolism
maf01100  Metabolic pathways
maf01120  Microbial metabolism in diverse environments
maf01200  Carbon metabolism
maf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:maf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAF_29720 (pca)
   00620 Pyruvate metabolism
    MAF_29720 (pca)
Enzymes [BR:maf01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     MAF_29720 (pca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATPgrasp_Ter Biotin_lipoyl_2 Dala_Dala_lig_C RnfC_N ATP-grasp GCV_H ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: CCC28042
UniProt: F8M4W6
Position
complement(3298309..3301692)
Genome map
AA seq 1127 aa AA seqDB search
MFSKVLVANRGEIAIRAFRAAYELGVGTVAVYPYEDRNSQHRLKADESYQIGDIGHPVHA
YLSVDEIVATARRAGADAIYPGYGFLSENPDLAAACAAAGISFVGPSAEVLELAGNKSRA
IAAAREAGLPVLMSSAPSASVDELLSVAAGMPFPLFVKAVAGGGGRGMRRVGDIAALPEA
IEAASREAESAFGDPTVYLEQAVINPRHIEVQILADNLGDVIHLYERDCSVQRRHQKVIE
LAPAPHLDAELRYKMCVDAVAFARHIGYSCAGTVEFLLDERGEYVFIEMNPRVQVEHTVT
EEITDVDLVASQLRIAAGETLEQLGLRQEDIAPHGAALQCRITTEDPANGFRPDTGRISA
LRTAGGAGVRLDGSTNLGAEISPYFDSMLVKLTCRGRDLPTAVSRARRAIAEFRIRGVST
NIPFLQAVLDDPDFRAGRVTTSFIDERPQLLTARASADRGTKILNFLADVTVNNPYGSRP
STIYPDDKLPDLDLRAAPPAGSKQRLVKLGPEGFARWLRESAAVGVTDTTFRDAHQSLLA
TRVRTSGLSRVAPYLARTMPQLLSVECWGGATYDVALRFLKEDPWERLATLRAAMPNICL
QMLLRGRNTVGYTPYPEIVTSAFVQEATATGIDIFRIFDALNNIESMRPAIDAVRETGSA
IAEVAMCYTGDLTDPGEQLYTLDYYLKLAEQIVDAGAHVLAIKDMAGLLRPPAAQRLVSA
LRSRFDLPVHLHTHDTPGGQLASYVAAWHAGADAVDGAAAPLAGTTSQPALSSIVAAAAH
TEYDTGLSLSAVCALEPYWEALRKVYAPFESGLPGPTGRVYHHEIPGGQLSNLRQQAIAL
GLGDRFEEIEEAYAGADRVLGRLVKVTPTSKVVGDLALALVGAGVSADEFASDPARFGIP
ESVLGFLRGELGDPPGGWPEPLRTAALAGRGAARPTAQLAADDEIALSSVGAKRQATLNR
LLFPSPTKEFNEHREAYGDTSQLSANQFFYGLRQGEEHRVKLERGVELLIGLEAISEPDE
RGMRTVMCILNGQLRPVLVRDRSIASAVPAAEKADRGNPGHIAAPFAGVVTVGVCVGERV
GAGQTIATIEAMKMEAPITAPVAGTVERVAVSDTAQVEGGDLLVVVS
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
gtgttttccaaggtgctcgtcgccaatcgcggggagatcgcgatccgggcctttcgtgcc
gcctacgaactgggcgtcggaaccgtggccgtttatccgtacgaggaccgcaattcgcag
caccgtctcaaggcggacgagtcttaccagatcggcgacatcggtcacccggtgcatgca
tacctgtcggtcgacgagatcgtcgcgacggcccgtcgggcgggtgccgacgctatctac
cctggctacgggtttctatcggagaatccggatctggctgcggcatgcgcggcggcgggc
atcagcttcgtcggtcccagcgccgaagtgcttgagctggctgggaataagtctcgcgcc
atcgcggcggcccgcgaagccggcttgcccgtgctgatgtcctcggcgccgtcggcctcg
gtcgacgaactgctgtcggttgcggccggcatgccgtttccgttgttcgtcaaggcagtt
gccggtggcgggggccggggtatgcgtcgtgtcggcgatatcgcggcgcttccggaggcg
atcgaagccgccagccgggaagccgagtcggcgttcggggacccgacggtctatctcgag
caggcagtgatcaatccacgccacatcgaggtgcagattctggcggacaacctcggcgac
gtgatccatctctatgagcgtgactgcagtgtgcagcgtcgccatcagaaggtcatcgag
ctggcgcccgcgccgcacctggacgccgagttgcgttacaagatgtgcgtcgatgcggtc
gccttcgcccgccatatcgggtacagctgcgcgggcaccgtcgagttcctgctggacgag
cgaggggagtatgtcttcatcgagatgaatccgcgggttcaggtggagcacacggtgacc
gaggagattaccgacgtcgacctggtcgccagccagctgcgcattgccgccggggagacg
ctcgaacaattgggcctgcggcaggaggacatcgcaccgcatggcgccgcactacagtgc
cggatcaccaccgaggatccggccaacggcttccggccggacacgggccggatcagcgcg
ttgcgcaccgccggcggtgccggtgtccgcctggacggcagcaccaacctgggcgcagaa
atcagcccgtacttcgactccatgctggtcaagctgacctgtcggggccgtgacctccct
accgcagtgagccgtgcgcgccgggcgatcgcggagttccggatccgcggggtatcgacg
aatattccgttcctgcaagcggtcctggatgacccggacttccgagcgggccgggtcacc
acgtccttcattgatgagcggccgcagctgctgaccgcgcgcgcctcggccgaccgcggc
accaagatccttaacttcctggccgatgtcaccgtcaacaacccgtatggctcgcgtccg
tcaacgatctacccggacgacaagctgcccgatcttgatctgcgggccgcaccaccggcc
gggtccaagcagcgactagtcaagttggggccggaaggatttgctcgttggctgcgggag
tcggccgcggtcggggtcaccgataccacattccgggatgctcaccagtcgttactggct
acccgagtacgcaccagcggactgtcgcgggtggcaccgtatctcgcgcggaccatgccg
cagctgttgtccgtggagtgttggggcggtgcgacttacgatgtggcgctgcgctttctc
aaggaggatccctgggaacggctggccacactgcgtgcagcaatgcccaatatctgcttg
cagatgctattgcggggccgcaataccgtgggctacacgccgtacccggaaatcgtgacg
tcggcgtttgtgcaagaagcaacagccaccggtatcgacatctttcgtatcttcgacgcg
ctcaacaacatcgagtcgatgcgtccggcgatcgacgcagtacgcgaaacaggttctgcg
atagcagaagtcgcgatgtgctacacgggcgaccttaccgatccgggtgaacagctgtac
acgctggactactacctgaaactggctgagcagatcgtggacgccggcgcccatgtgctg
gcgatcaaggatatggctggactgttgcgcccgccggccgctcaaaggttggtcagcgcc
ctgcgcagtcgcttcgacctgcccgttcacctgcacacccacgacacaccgggtggccag
ctcgccagctatgtggccgcttggcacgccggggccgatgccgtcgacggcgccgccgcg
ccgctggcgggaacgaccagccagcccgcgctgagctcgatcgttgctgccgctgcccac
accgagtacgacaccggcctgtcgctttcggcggtgtgcgccctggagccgtactgggag
gcgttacgaaaagtgtatgcgccgttcgagtctgggttgccggggccgacggggcgggtt
tatcaccacgagattccgggcggccaactgtccaatctgcgccagcaagcaattgctctt
ggtctgggagatcgattcgaagagatcgaagaggcctacgcgggcgccgaccgagtgttg
ggcaggctggttaaggtcacgccaacgtccaaggtggtcggcgatctggcgctggcactg
gtcggcgccggtgtcagtgcagacgaattcgcctccgatccagcgcgatttggcatcccg
gaatcggtactcggatttctgcggggcgagctgggtgatccgcccggcgggtggcccgaa
ccgctgcgcactgcggcgctggccggtcgcggggcggccaggcccactgcgcaattggcg
gcggacgacgagattgccctatcgtcggtcggagccaagcgtcaggccaccctgaacagg
ctgttatttcccagtccaacaaaggaattcaatgagcaccgggaagcctacggcgacacg
tcgcaattgtcggccaaccagttcttctatggtctgcgccaaggtgaagagcatcgggtg
aagctggagcgtggggtggagctgttgatcgggctggaggccatttccgaacccgacgaa
cgcggcatgcgaacggtgatgtgcatcctcaacgggcagctgcggccggtgctagtgcgc
gaccgcagcattgccagtgccgttccggccgccgagaaggccgaccgcggcaatcccgga
cacatcgccgcgccatttgccggagtcgtcacggtcggggtgtgcgtcggcgagcgggtc
ggcgccggccaaaccatcgccaccatcgaggcgatgaagatggaagccccgatcaccgcc
ccggttgccggcaccgtggagcgggtggcggtgtcggacaccgcccaggtggagggcgga
gacctgttggtggtggtgagctga

DBGET integrated database retrieval system