KEGG   Mycobacterium africanum: MAF_29760Help
Entry
MAF_29760         CDS       T01575                                 

Definition
(GenBank) conserved hypothetical protein
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red Herpes_gI
Motif
Other DBs
NCBI-ProteinID: CCC28046
UniProt: F8M4X0
Position
3304580..3304750
Genome map
AA seq 56 aa AA seqDB search
MLIRWHIQLGNIVIPKSVNPMRIASNFDAFDFPRSMTEPGLVRIRKPSISQAGEMT
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
gtgttgattaggtggcatatccaactcggtaatatcgtgatccccaagtcggtgaaccca
atgcggattgcgagcaacttcgacgcgttcgatttccctcgctcgatgacggaacccggc
ttggtccgaatccgaaaaccttcaatttcacaggcaggtgagatgacgtga

DBGET integrated database retrieval system