KEGG   Mycobacterium africanum: MAF_29800Help
Entry
MAF_29800         CDS       T01575                                 

Definition
(GenBank) conserved hypothetical alanine rich protein
  KO
K07030  uncharacterized protein
Organism
maf  Mycobacterium africanum
Brite
KEGG Orthology (KO) [BR:maf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    MAF_29800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1_2 Dak2
Motif
Other DBs
NCBI-ProteinID: CCC28050
UniProt: F8M4X4
Position
complement(3308595..3310256)
Genome map
AA seq 553 aa AA seqDB search
MGTADRPLDASALRDWAHAVVSDLILHIDEINRLNVFPVADSDTGVNMLFTMRAAVVEAD
LHANSQADAEDVARVAAALAAGALNGARGNSGVILSQILRGIAEVTATAAAASGAVLRAV
DANALGAALWRGVELVVASMGGVEVPGTIVSVLRAAAGAVDQCAHEGLAGAVTAAGDAAV
IALEKTPEQLDVLADAGAVDAGGRGLLVLLDALRSTICGQAPARAVYEPSPRALPTDTAT
QRPAPQFEVMYLLAVCDAAAADQLRDRLKELGESVAIAAAPPDSYSVHVHTDDAGAAVEA
GLAVGRVSRIVISALGSGTSGLPAGGWTRGRAVLAVVDGDGAAELFAGEGACVLRPGPDA
VTPAADISAHQLVRAVVDTGAAHVMVLPNGYVAAEELVAGCTAAIGWGVDVVPVPTGSMV
QGLAALAVHDAARQAVDDGYSMARAAGASRHGSVRIATQKALTWAGTCKPGDGLGIAGDE
VLIVADDVAAAAIGLVDLLLASGGDLVTVLIGAGVTEDVAVVLERHVHDHHPGTELVSYR
TGHRGDALLIGVE
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtggggacggcggatcggccgttggacgcctcggccttgcgggactgggcacacgccgtc
gtcagcgatctgatcctccacatcgacgagatcaaccggctcaatgtgttcccggtcgct
gactccgataccggcgtcaacatgctgttcaccatgcgtgccgcggtcgtagaagctgat
ttgcacgcgaattcgcaggctgacgccgaagacgtggcgcgggttgcggccgctctcgcg
gccggcgcgttgaacggagctcgcggcaactccggcgtgatcctgtcccagatcctgcgc
gggatcgcagaggtgaccgcgactgcggccgccgcctctggcgcggtattgcgggcggtc
gacgccaacgccctcggggccgcgttgtggcgcggcgtcgagttggtcgtcgcgtcgatg
ggtggcgtggaggtgccgggaactatcgtctcggtgctgcgggccgccgccggagccgtc
gaccagtgcgcgcacgaggggttggccggtgcggtcaccgccgccggtgacgcggcggtc
atcgcgctggaaaagacccccgaacagcttgacgtgctcgccgatgcgggcgcggtggac
gccggcggacggggcctgctggttctgctggacgcgttgcgctccaccatctgcgggcag
gcacctgcccgggcggtctacgaaccctcgccgcgcgcgttgccgaccgacacggctacc
caacgccccgccccgcaattcgaggtgatgtatctgttggcggtatgtgatgctgcagcg
gcggaccagttgcgggatcgactcaaggaattgggtgagtcggtggccatcgccgctgct
ccgcccgacagctactccgtacacgtccacaccgacgacgccggtgccgccgtggaagcc
ggattggcggtggggcgagttagccggatcgtgatctcggcgctcggttccgggaccagc
ggattgccggccggtggctggacgcggggccgcgccgtgctggcggtcgtcgacggcgac
ggtgccgccgagctgttcgccggggagggcgcctgcgtgctgcgaccgggtccagacgcc
gtgacaccggccgccgatatcagtgcccaccagctggtgcgggccgtggtagacaccggc
gccgcgcacgtgatggtgctgcccaatggctatgtggccgccgaagaactggtggccggg
tgtaccgcggcgatcggctggggcgtcgacgtggtacccgtgccgaccggatcgatggtg
caggggttggccgcgctggccgtgcatgacgcggcccgccaggccgtcgacgacggctac
agcatggcccgtgccgccggtgcttcccggcacggatcggtgcgcattgccacccaaaag
gcgctgacctgggccggtacctgcaagccgggcgacggtctgggtatcgcgggcgacgag
gtgctgatcgtcgccgacgatgtcgccgcggcggccatcggtctggtcgacctgttgttg
gcatcgggaggcgatctggtgacggtgctaattggcgccggcgtaaccgaagacgtggct
gtcgtcctggaacggcatgtgcacgaccaccatccaggcaccgagctggtctcctaccgc
accggacaccgcggcgacgcgctgctgatcggggtcgagtag

DBGET integrated database retrieval system