KEGG   Mycobacterium africanum: MAF_30000Help
Entry
MAF_30000         CDS       T01575                                 

Gene name
leuB
Definition
(GenBank) putative 3-isopropylmalate dehydrogenase LEUB (beta-IPM dehydrogenase)
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
maf  Mycobacterium africanum
Pathway
maf00290  Valine, leucine and isoleucine biosynthesis
maf00660  C5-Branched dibasic acid metabolism
maf01100  Metabolic pathways
maf01110  Biosynthesis of secondary metabolites
maf01210  2-Oxocarboxylic acid metabolism
maf01230  Biosynthesis of amino acids
Module
maf_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:maf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    MAF_30000 (leuB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    MAF_30000 (leuB)
Enzymes [BR:maf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     MAF_30000 (leuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CCC28070
Position
complement(3331397..3332407)
Genome map
AA seq 336 aa AA seqDB search
MKLAIIAGDGIGPEVTAEAVKVLDAVVPGVQKTSYDLGARRFHATGEVLPDSVVAELRNH
DAILLGAIGDPSVPSGVLERGLLLRLRFELDHHINLRPARLYPGVASPLSGNPGIDFVVV
REGTEGPYTGNGGAIRVGTPNEVATEVSVNTAFGVRRVVADAFERARRRRKHLTLVHKTN
VLTLAGGLWLRTVDEVGECYPDVEVAYQHVDAATIHMITDPGRFDVIVTDNLFGDIITDL
AAAVCGGIGLAASGNIDATRANPSMFEPVHGSAPDIAGQGIADPTAAIMSVALLLSHLGE
HDAAARVDRAVEAHLATRGSERLATSDVGERIAAAL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgcgatcattgccggtgacgggatcgggcccgaggtaaccgccgaggcggtc
aaagtgctcgacgcggttgtgccgggcgtccagaaaaccagctatgacctgggtgcgcgg
cgctttcatgccaccggcgaggtgctgccggactcggtggtggccgagctgcgcaaccac
gacgcgatcctgctcggggcgatcggtgacccgtcggtgccaagcggcgtcttggagcgc
ggtctgttgctgcgactgcgcttcgagctggatcaccacatcaacctgcgtccggcccgg
ctgtatccgggggtggccagcccgctgtccggcaatcccggcatcgacttcgtggtggtg
cgcgagggcaccgagggaccctacacgggcaacggcggggcgattcgcgtcggcacgccc
aacgaggtggccaccgaagtcagcgtgaacaccgcgttcggtgtgcggcgtgtggttgcc
gacgcgttcgagcgggctcgacggcgtcgcaagcatctgacattggtgcacaaaaccaac
gtgttgaccctcgccgggggattgtggttgcggaccgtcgacgaggtcggcgaatgctac
ccggacgtcgaggtggcctaccagcacgtcgacgccgccaccatccacatgatcaccgac
ccgggtcgcttcgacgtgatcgtcaccgacaacctgttcggcgacatcatcaccgatctg
gccgcggcggtatgtggcggtatcggcttggcggccagtgggaatatcgacgcgacccgg
gccaacccgtcgatgttcgagccggtgcatggcagcgcgccggacatcgccggtcagggc
atcgccgacccgacggcggcgatcatgtcggtggcgttattgctgtcccaccttggcgaa
cacgacgcggctgcccgggtggaccgggccgtcgaggcccatttggccacgcgtggcagc
gaacggcttgccaccagcgatgtcggcgaacggattgccgccgcgctctag

DBGET integrated database retrieval system