KEGG   Mycobacterium africanum: MAF_30020Help
Entry
MAF_30020         CDS       T01575                                 

Definition
(GenBank) putative alanine rich dehydrogenase
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_8 Thi4 FAD_oxidored DAO FAD_binding_3 FAD_binding_2 HI0933_like Pyr_redox_2 3HCDH_N Pyr_redox_3 Amino_oxidase Lycopene_cycl Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: CCC28072
UniProt: F8M4Z6
Position
3334038..3335480
Genome map
AA seq 480 aa AA seqDB search
MDVTVVGSGPNGLATAVICARAGLNVQVVEAQATFGGGARSAADFEFPEVLHDVCSAVHP
LALASPFFAEFDLPARGVTLTVPDIAYANPLPGRPAAIAYHDLAHTCAKLDDGASWRRLL
GPLVAHSETVVEFMLSDKRSLPTALGSVLRLGLRMLAQGTPAWRSLAGEDARALFTGVAA
HAISPLPSLVSAGAGLMLATLAHSVGWPIPVGGTQAIADALIADLRAHGGRLAAGVEITE
PQRSVVVFDTAPTALLRVYRDKLPHRYAKALRRYRFRAGIAKVDFVLSDEIPWSDPRLRR
AATLHLGGTRDQMARAEADVAAGRHADWPMVLAACPHVADPGRIDETGRRPFWTYAHVPS
GSTLDATETVTSVLERFAPGFRDIVVAARAVPAARMADHNANYVGGDITVGANSTWRAIA
GPTPRLNPWRTPIPKVYLCSAATPPGAGVHGMCGWYAARTLLRTEFGITRMPPLGHELRP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtcaccgtcgtcggcagcggacccaacgggctcgccacggccgtcatctgcgcc
cgcgcgggcctgaacgtgcaggtcgtcgaggcccaggcgaccttcggcggcggcgcccgc
agcgcggccgacttcgaatttcccgaagttttacacgacgtgtgctccgcggtgcatccg
cttgctttggcgtcgccgtttttcgccgaattcgacctacccgcgcgcggagtgacgctg
accgtgcccgacatcgcctacgccaacccgctacccgggcggcccgcggcgatcgcctat
cacgatctggcgcacacctgcgccaagctggacgacggcgcgtcctggcggcgcctgctg
ggcccgttggtggcgcactcggagacggtcgtggagttcatgctctccgacaagcggtct
ttgcctactgcactgggctcggtcctgcgtctcgggctgcggatgctggcccagggcacc
cctgcctggcggtcgctggcgggcgaggatgcccgcgcgttgttcaccggcgttgccgcc
cacgcgatttcaccgttgccgtcactggtgtcggccggcgccggactgatgctggcaacg
ctggcccattcggtcggctggccgattccggtgggcggcacccaggcgatagccgacgcg
ctgatcgccgatctacgcgcgcatggtggtcggctcgcggccggtgtcgagatcaccgaa
ccgcaaagaagtgtggtcgtcttcgacaccgcacccaccgccctgctgcgggtttaccgc
gacaagcttccacatcggtatgccaaagcattgcgccgctatcgatttcgcgctggcatc
gccaaggtggacttcgtgctcagcgacgagatcccgtggtcggatccgcggctgcggcgg
gctgcgaccctgcatctcggcggcacccgtgaccagatggcgcgcgccgaggcagacgtc
gcggcgggacgccacgccgactggccgatggtgctggccgcgtgtccgcacgtcgccgac
cccggccgcatcgacgaaaccggccgccgtccgttctggacctatgcccacgtgccgtcg
gggtccacgctcgacgcgaccgagaccgtaaccagcgtcctcgagcggttcgcccccggc
ttccgtgacatcgtggtggcggcccgcgccgtgcccgccgcgcggatggccgaccacaac
gccaactacgtcggcggtgacatcacggtcggcgccaactcgacctggcgcgcgatcgcc
ggccccaccccgcggttgaatccctggcgcacaccgattcccaaggtgtacctgtgttct
gcggcgactccgcccggcgccggcgtgcacggcatgtgcggctggtatgccgctcgaacg
ctgttgcgcaccgagttcggcatcacccgcatgccccccttgggccatgagctgaggcca
taa

DBGET integrated database retrieval system