KEGG   Mycobacterium africanum: MAF_30070Help
Entry
MAF_30070         CDS       T01575                                 

Gene name
ilvC
Definition
(GenBank) putative ketol-acid reductoisomerase ILVC (acetohydroxy-acid isomeroreductase)
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
maf  Mycobacterium africanum
Pathway
maf00290  Valine, leucine and isoleucine biosynthesis
maf00770  Pantothenate and CoA biosynthesis
maf01100  Metabolic pathways
maf01110  Biosynthesis of secondary metabolites
maf01130  Biosynthesis of antibiotics
maf01210  2-Oxocarboxylic acid metabolism
maf01230  Biosynthesis of amino acids
Module
maf_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
maf_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:maf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    MAF_30070 (ilvC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MAF_30070 (ilvC)
Enzymes [BR:maf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     MAF_30070 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C NAD_binding_2 F420_oxidored AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: CCC28077
UniProt: F8M501
Position
complement(3338524..3339525)
Genome map
AA seq 333 aa AA seqDB search
MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRSRPKVEEQGLD
VDTPAEVAKWADVVMVLAPDTAQAEIFAGDIEPNLKPGDALFFGHGLNVHFGLIKPPADV
AVAMVAPKGPGHLVRRQFVDGKGVPCLVAVEQDPRGDGLALALSYAKAIGGTRAGVIKTT
FKDETETDLFGEQTVLCGGTEELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGG
LARMYYSVSDTAEFGGYLSGPRVIDAGTKERMRDILREIQDGSFVHKLVADVEGGNKQLE
ELRRQNAEHPIEVVGKKLRDLMSWVDRPITETA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttctacgacgacgacgcagacctgtcgatcattcagggccgcaaggttggtgtgatc
ggctacggcagccaggggcacgcgcactcgctaagcctgcgcgactcgggtgtgcaggtg
cgcgtcgggctgaagcagggttcgcggtcgcggcccaaggtagaagagcagggcctggac
gtcgacactcccgccgaggtcgccaaatgggccgatgtggtcatggtgttggcccccgac
accgcccaggccgagatcttcgcaggagacatcgaacccaacctcaagcccggtgacgcg
ctgttcttcggtcacggactcaacgttcacttcggcttgatcaagccgcccgccgacgtc
gccgtcgcgatggtcgccccgaagggaccgggtcatttggtgcgccgccagttcgtcgac
ggcaagggtgtgccgtgtttggttgcggtagagcaggatccgcgaggcgacggcttggcg
ctggcgctgtcgtatgccaaagcgatcggcggcacccgggccggcgtcatcaagacgacg
ttcaaagacgagaccgaaaccgacctgttcggtgagcaaacggtgttgtgcggcggcacc
gaggaattggtcaaggccgggttcgaggtcatggtcgaagccggctaccccgcggaattg
gcctacttcgaggtgctgcacgagctgaagctgatcgtcgacttgatgtacgagggtggc
ctggcgcggatgtactactcggtgtcggacaccgcggaattcggcggctacctctcaggc
ccgcgcgtcatcgatgccggcaccaaggagcggatgcgcgacatcctgcgggagatccag
gacggtagctttgtccacaagctggtcgccgacgtcgagggcggcaacaaacagctcgaa
gagttgcgccggcaaaacgccgagcaccccatcgaggtcgtcggcaagaaactccgcgac
ctgatgagctgggtggaccgcccgatcaccgagacggcctag

DBGET integrated database retrieval system