KEGG   Mycobacterium africanum: MAF_30090Help
Entry
MAF_30090         CDS       T01575                                 

Gene name
ilvB1
Definition
(GenBank) putative acetolactate synthase (large subunit) ILVB1 (acetohydroxy-acid synthase)
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
maf  Mycobacterium africanum
Pathway
maf00290  Valine, leucine and isoleucine biosynthesis
maf00650  Butanoate metabolism
maf00660  C5-Branched dibasic acid metabolism
maf00770  Pantothenate and CoA biosynthesis
maf01100  Metabolic pathways
maf01110  Biosynthesis of secondary metabolites
maf01130  Biosynthesis of antibiotics
maf01210  2-Oxocarboxylic acid metabolism
maf01230  Biosynthesis of amino acids
Module
maf_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
maf_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:maf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MAF_30090 (ilvB1)
   00660 C5-Branched dibasic acid metabolism
    MAF_30090 (ilvB1)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    MAF_30090 (ilvB1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MAF_30090 (ilvB1)
Enzymes [BR:maf01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     MAF_30090 (ilvB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-ProteinID: CCC28079
UniProt: F8M503
Position
complement(3340069..3341925)
Genome map
AA seq 618 aa AA seqDB search
MSAPTKPHSPTFKPEPHSAANEPKHPAARPKHVALQQLTGAQAVIRSLEELGVDVIFGIP
GGAVLPVYDPLFDSKKLRHVLVRHEQGAGHAASGYAHVTGRVGVCMATSGPGATNLVTPL
ADAQMDSIPVVAITGQVGRGLIGTDAFQEADISGITMPITKHNFLVRSGDDIPRVLAEAF
HIAASGRPGAVLVDIPKDVLQGQCTFSWPPRMELPGYKPNTKPHSRQVREAAKLIAAARK
PVLYVGGGVIRGEATEQLRELAELTGIPVVTTLMARGAFPDSHRQNLGMPGMHGTVAAVA
ALQRSDLLIALGTRFDDRVTGKLDSFAPEAKVIHADIDPAEIGKNRHADVPIVGDVKAVI
TELIAMLRHHHIPGTIEMADWWAYLNGVRKTYPLSYGPQSDGSLSPEYVIEKLGEIAGPD
AVFVAGVGQHQMWAAQFIRYEKPRSWLNSGGLGTMGFAIPAAMGAKIALPGTEVWAIDGD
GCFQMTNQELATCAVEGIPVKVALINNGNLGMVRQWQSLFYAERYSQTDLATHSHRIPDF
VKLAEALGCVGLRCEREEDVVDVINQARAINDCPVVIDFIVGADAQVWPMVAAGTSNDEI
QAARGIRPLFDDITEGHA
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcaccaaccaagccacactcaccgacattcaagccagagccacacagcgcggcg
aatgagccaaagcacccggcggctcgtccgaaacatgttgcactgcagcagcttaccggt
gcacaggcggtcatccggtcgctggaggaactcggcgtcgacgtcattttcgggattccg
ggcggtgcggtgctgccggtgtatgacccgctgttcgactcgaaaaagctgcgccacgtg
ctggtccgccacgaacagggcgccgggcatgccgccagcggctacgcgcacgtcaccggc
cgggtgggcgtgtgcatggcaacgtcgggtcccggagcgaccaacctggtgaccccgctg
gccgacgcgcagatggactcgatcccggtggtcgctatcaccggtcaggtcgggcggggg
ctgatcggcaccgacgccttccaggaggccgacatctcgggcatcacgatgccgatcacc
aagcacaactttctggtccgctccggtgacgacattccgcgggtgctggccgaggccttc
cacatcgcggcctccggccgtccgggcgcggtgctggtcgacatccccaaggacgtgctg
cagggccagtgcacgttcagctggccgccgcggatggagctgcccggctacaagcccaac
accaaaccgcacagccggcaggtccgcgaggccgccaagctgatcgcggccgcgcgcaag
ccggtgctgtatgtcggcggcggcgtcatccgcggtgaggccaccgagcagctccgggag
ctggccgagctgaccggcatcccggtggtcaccacgctgatggcccgcggcgcgtttccc
gacagccaccggcaaaacctcggcatgcccggcatgcacggcacggtggccgccgtggcg
gcgctgcagcgcagcgacctgctgatcgcgctgggtacccgcttcgacgaccgggtgacc
ggcaagctcgactcgttcgcgccggaagccaaggtcatccacgccgacatcgacccggcc
gagatcggcaagaaccgccacgccgacgtgcccatcgtcggtgacgtcaaggccgtcatc
accgaactgatcgcgatgctgcgccaccaccacattcccggcaccatcgagatggccgac
tggtgggcatacctgaacggtgtgcgcaagacctatccgctgagctatgggccgcagagc
gacggcagcctgagcccggaatacgtgatcgaaaagctcggcgagatcgccgggccggac
gccgtcttcgtcgccggcgtcggccagcaccagatgtgggccgcgcagttcatcagatac
gaaaagccgcgcagctggctgaactccggcggtctgggcaccatggggtttgccatcccg
gcggccatgggcgccaagatcgccctccccggcaccgaggtctgggcgatcgacggcgac
ggttgcttccagatgaccaaccaggagctggccacctgcgcggtcgagggcataccggtc
aaggtggcgctgatcaacaacggcaacctgggcatggtgcggcagtggcagagcctgttc
tatgccgagcggtactcgcagaccgacctggccactcattcgcaccgcatccccgacttc
gtgaaactggccgaggccttggggtgtgtggggttgcggtgcgagcgggaagaggacgtc
gtcgacgtcatcaaccaggcgcgggcgatcaacgactgcccggtggtgatcgacttcatc
gtcggtgccgacgcgcaagtgtggccgatggtggccgcgggcaccagcaatgacgagatc
caggccgcccgcggcattcgccccctgttcgacgacatcaccgaaggccacgcctga

DBGET integrated database retrieval system