KEGG   Mycobacterium africanum: MAF_30490Help
Entry
MAF_30490         CDS       T01575                                 

Gene name
serB2
Definition
(GenBank) putative phosphoserine phosphatase SERB2 (PSP) (O-phosphoserine phosphohydrolase)
  KO
K01079  phosphoserine phosphatase [EC:3.1.3.3]
Organism
maf  Mycobacterium africanum
Pathway
maf00260  Glycine, serine and threonine metabolism
maf00680  Methane metabolism
maf01100  Metabolic pathways
maf01120  Microbial metabolism in diverse environments
maf01130  Biosynthesis of antibiotics
maf01200  Carbon metabolism
maf01230  Biosynthesis of amino acids
Module
maf_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:maf00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MAF_30490 (serB2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAF_30490 (serB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:maf01009]
    MAF_30490 (serB2)
Enzymes [BR:maf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     MAF_30490 (serB2)
Protein phosphatases and associated proteins [BR:maf01009]
 HAD phosphatases
  Other HAD phosphatases
   MAF_30490 (serB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD ACT_6 Hydrolase Hydrolase_3 ACT S6PP HAD_2 ACT_7 Put_Phosphatase Toxin_ToxA DUF705 Acid_PPase
Motif
Other DBs
NCBI-ProteinID: CCC28119
Position
complement(3380873..3382102)
Genome map
AA seq 409 aa AA seqDB search
MPAKVSVLITVTGMDQPGVTSALFEVLAQHGVELLNVEQVVIRGRLTLGVLVSCPLDVAD
GTALRDDVAAAIHGVGLDVAIERSDDLPIIRQPSTHTIFVLGRPITAGAFSAVAREVAAL
GVNIDFIRGISDYPVTGLELRVSVPPGCVGPLQIALTKVAAEEHVDVAVEDYGLAWRTKR
LIVFDVDSTLVQGEVIEMLAARAGAQGQVAAITEAAMRGELDFAESLQRRVATLAGLPAT
VIDDVAEQLELMPGARTTIRTLRRLGFRCGVVSGGFRRIIEPLARELMLDFVASNELEIV
DGILTGRVVGPIVDRPGKAKALRDFASQYGVPMEQTVAVGDGANDIDMLGAAGLGIAFNA
KPALREVADASLSHPYLDTVLFLLGVTRGEIEAADAGDCGVRRVEIPAD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaaggtgtcggtgctgatcacggtcaccggcatggatcagccaggcgtgaca
tccgcgctcttcgaggtgctcgcgcagcacggagtcgagctgctcaacgtcgaacaagtg
gtgatccggggccggctcacgctgggtgtgctggtgtcgtgcccgctggacgttgccgac
ggtaccgcgctgcgcgacgacgtcgcggccgccatccacggggtgggtctagacgtcgcc
atcgagcgcagcgacgatctgccaatcattcggcaaccgtccacccacaccattttcgtg
ctgggacgcccgattaccgccggagcgttcagcgcggtggccagggaagtggccgcactc
ggcgtcaacatcgacttcatccgcggcatttccgactacccggtcaccggcctggagttg
cgggtctcggtgccgcctggatgcgtgggtccgctgcagatcgccctgaccaaggtggcc
gccgaagagcatgtcgatgtggccgtcgaggactacggcttggcttggcgcaccaaacgc
ctgatcgtcttcgacgtcgactccactctggtccaaggcgaggtcatcgagatgctggca
gcccgtgcgggtgcccagggacaggtcgccgcgatcaccgaggccgcgatgcgtggtgag
ctggacttcgccgagtcgctgcagcgtcgtgttgccaccttggcggggctgcccgcgacg
gtgatagacgacgtcgccgagcagctcgaactgatgcccggtgctcggaccacgatccgg
accttgcggcgtctgggttttcgctgcggtgtggtttccggcggctttcggcggatcatc
gagccgctcgcacgcgagttgatgttggatttcgttgcgtccaacgagctggaaatcgtc
gatggcattcttaccggccgggtcgtggggccgattgttgaccggcccggcaaggccaag
gcgcttcgggacttcgcgagccagtatggggtgccgatggagcagaccgtcgcggtcggc
gacggcgccaacgatatcgacatgctgggcgcggccgggctgggaatagcattcaacgcc
aagccggcgttgcgtgaggtcgccgatgcgtcgttgagccatccgtacctggacacggtg
ttgttcttgttgggcgtgactcgcggtgagatcgaggccgccgacgccggcgactgtggg
gtgcgtcgcgtcgaaatcccggccgactag

DBGET integrated database retrieval system