KEGG   Mycobacterium tuberculosis variant africanum: MAF_30560Help
Entry
MAF_30560         CDS       T01575                                 

Definition
(GenBank) putative monooxygenase
Organism
maf  Mycobacterium tuberculosis variant africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_3 FMO-like NAD_binding_8 K_oxygenase Pyr_redox_2 DAO FAD_binding_2 NAD_binding_9 FAD_binding_3 Pyr_redox Amino_oxidase Thi4 HI0933_like
Motif
Other DBs
NCBI-ProteinID: CCC28126
Position
complement(3388449..3390023)
Genome map
AA seq 524 aa AA seqDB search
MSIADTAAKPSTPSPANQPPVRTRAVIIGTGFSGLGMAIALQKQGVDFVILEKADDVGGT
WRDNTYPGCACDIPSHLYSFSFEPKADWKHLFSYWDEILGYLKGVTDKYGLRRYIEFNSL
VDRGYWDDDECRWHVFTADGREYVAQFLISGAGALHIPSFPEIAGRDEFAGPAFHSAQWD
HSIDLTGKRVAIVGTGASAIQIVPEIVGQVAELQLYQRTPPWVVPRTNEELPVSLRRALR
TVPGLRALLRLGIYWAQEALAYGMTKRPNTLKIIEAYAKYNIRRSVKDRELRRKLTPRYR
IGCKRILNSSTYYPAVADPKTELITDRIDRITHDGIVTADGTGREVFREADVIVYATGFH
VTDSYTYVQIKGRHGEDLVDRWNREGIGAHRGITVANMPNLFFLLGPNTGLGHNSVVFMI
ESQIHYVADAIAKCDRMGVQALAPTREAQDRFNQELQRRLAGSVWNSGGCRSWYLDEHGK
NTVLWCGYTWQYWLTTRSVNPAEYRFFGIGNGLSSDRATVAAAN
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgagcattgccgatacggctgccaagccgtccacgccaagcccggccaaccagccgccg
gtacgtacccgcgccgtcatcatcggaaccggattctccggtttgggcatggccatcgca
ctgcaaaagcaaggagtggacttcgtcatattggagaaagccgacgacgtcggcggcacc
tggcgcgacaacacctaccccggctgcgcgtgcgacatcccgtcgcacctgtactccttc
tcgttcgagcccaaggcggactggaaacacctgttttcctactgggacgaaatcttgggc
tacctcaaaggggtcaccgacaagtacggcctgcgccgctacatcgagttcaattcgctc
gtcgatcgcggctactgggacgacgacgaatgccgctggcacgtgttcaccgccgacggg
cgtgaatacgtcgcgcagttcctgatctccggggccggtgcgttgcacatcccgtccttc
cccgagatcgcaggtcgcgacgaattcgccggccccgctttccattccgcccagtgggac
cacagtatcgacctgaccggcaagcgggtggcgatcgtcgggaccggtgccagcgcgatc
cagatcgtgcccgagatcgtcggccaggtcgccgaacttcagctctatcagcgcaccccg
ccgtgggtggtcccgcgcaccaacgaagagctgccggtgtcgctgcgccgggcgttgcga
accgtccccgggctacgggcactgttgcgcctcggcatctactgggcccaggaggcgctg
gcctacggcatgaccaagcggcccaacacgttgaagatcatcgaggcctatgccaaatac
aatattcgtcgatcggtgaaggatcgcgagctgcggcgcaagctgacgccgcggtatcgc
atcggctgcaaacggatcctgaactcctctacctattaccccgcggtggcggacccgaag
accgaactgatcaccgaccgcatcgaccggatcacgcacgacgggatcgtcaccgccgac
ggcactggccgtgaggtcttccgggaagccgatgtgatcgtgtacgccaccggcttccac
gtcaccgactcctatacctatgtgcagatcaaggggcgtcacggcgaggacctggtcgac
cgctggaaccgtgagggcatcggtgcacaccgcgggatcaccgtcgccaacatgcccaac
ctgttcttcctgctggggccgaacactgggctgggacacaactccgtggtgttcatgatc
gaatcgcagatccattacgtggccgatgcgatcgcgaaatgcgaccggatgggcgtgcaa
gcgctggcccccacccgcgaggcgcaagaccggttcaaccaggagctgcagcgcaggctg
gctgggtcggtgtggaacagtggcggctgccgcagctggtatctcgacgagcacggcaag
aacaccgtgctctggtgcggctacacctggcaatactggctgaccacccgctcggtcaac
cccgccgagtaccggttcttcgggatcggcaacggtttgtcgagcgaccgcgcgacggtc
gctgcggcgaactag

DBGET integrated database retrieval system