KEGG   Mycobacterium africanum: MAF_30590Help
Entry
MAF_30590         CDS       T01575                                 

Gene name
nrdI
Definition
(GenBank) putative NRDI protein
  KO
K03647  protein involved in ribonucleotide reduction
Organism
maf  Mycobacterium africanum
Brite
KEGG Orthology (KO) [BR:maf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99984 Nucleotide metabolism
    MAF_30590 (nrdI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_NdrI
Motif
Other DBs
NCBI-ProteinID: CCC28129
UniProt: F8M5I5
Position
complement(3393172..3393624)
Genome map
AA seq 150 aa AA seqDB search
MDIAGRSLVYFSSVSENTHRFVQKLGIPATRIPLHGRIEVDEPYVLILPTYGGGRANPGL
DAGGYVPKQVIAFLNNDHNRAQLRGVIAAGNTNFGAEFCYAGDVVSRKCSVPYLYRFELM
GTEDDVAAVRTGLAEFWKEQTCHQPSLQSL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcggggcgcagcctggtctatttctccagcgtgtcggagaacacccaccgc
tttgtgcagaaactgggtattcccgccacgcggataccgctgcatggccggatcgaggtc
gacgagccgtacgtgctgatactgcccacctacggtggcggccgggccaacccgggtctc
gatgccggcggatacgtccccaaacaggtcattgccttcttgaacaacgaccacaatcga
gcgcagctgcgcggggtcatcgctgccggcaataccaacttcggtgccgagttctgctac
gccggcgacgtcgtctcccgaaaatgtagcgttccctacctataccgcttcgaactgatg
ggcaccgaggacgacgtcgccgccgtccgcaccggtctcgctgaattctggaaggaacag
acgtgccaccaaccgtcattgcagagcctgtag

DBGET integrated database retrieval system