KEGG   Mycobacterium africanum: MAF_30600Help
Entry
MAF_30600         CDS       T01575                                 

Gene name
nrdH
Definition
(GenBank) putative glutaredoxin electron transport component of NRDEF (glutaredoxin-like protein) NRDH
  KO
K06191  glutaredoxin-like protein NrdH
Organism
maf  Mycobacterium africanum
Brite
KEGG Orthology (KO) [BR:maf00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    MAF_30600 (nrdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin DUF836 SH3BGR
Motif
Other DBs
NCBI-ProteinID: CCC28130
UniProt: F8M5I6
Position
complement(3393659..3393898)
Genome map
AA seq 79 aa AA seqDB search
MTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDH
WSGFRPDRIKALAGAALTA
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaccgtttacactaagcccgcgtgcgtacagtgcagtgccacctccaaggcg
ctggacaagcagggcatcgcctaccagaaggttgatatcagcctggattccgaagcgcgg
gactacgtgatggcgctgggttacctacaagcacccgtcgtggtcgccggaaacgaccac
tggtcgggtttccgccccgatcgcatcaaggcgctcgccggggcagcgctgaccgcctag

DBGET integrated database retrieval system