KEGG   Mycobacterium africanum: MAF_30720Help
Entry
MAF_30720         CDS       T01575                                 

Gene name
mmr
Definition
(GenBank) multidrugs-transport integral membrane protein MMR
  KO
K03297  small multidrug resistance pump
Organism
maf  Mycobacterium africanum
Brite
KEGG Orthology (KO) [BR:maf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:maf02000]
    MAF_30720 (mmr)
Transporters [BR:maf02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   MAF_30720 (mmr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA EmrE TPT
Motif
Other DBs
NCBI-ProteinID: CCC28142
Position
3409381..3409704
Genome map
AA seq 107 aa AA seqDB search
MIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAY
ALWSAIGTAAIVLVAVLFLGSPISVMKVVGVGLIVVGVVTLNLAGAH
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
ttgatctacctatacctcttgtgcgcgatcttcgcggaagtggtggcaaccagcctgctc
aaaagcacggaagggttcactcggttgtggcccacggtgggctgtctagtgggttatggc
atcgctttcgcgctgctggccttgtcgatctcgcacggcatgcagacggacgtcgcctat
gcgctgtggtcggcaatcggtacggccgccattgtgctggtcgccgtactgtttctcggc
tcgccgatatctgtgatgaaggtggttggcgtcggcctgattgtcgtcggcgtggtcacg
ttgaacctggcgggtgcccattga

DBGET integrated database retrieval system