KEGG   Mycobacterium africanum: MAF_30730Help
Entry
MAF_30730         CDS       T01575                                 

Definition
(GenBank) putative transcriptional regulatory protein (probably DEOR-family)
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N
Motif
Other DBs
NCBI-ProteinID: CCC28143
UniProt: F8M5J9
Position
3409701..3410309
Genome map
AA seq 202 aa AA seqDB search
MTAGSDRRPRDPAGRRQAIVEAAERVIARQGLGGLSHRRVAAEANVPVGSTTYYFNDLDA
LREAALAHAANASADLLAQWRSDLDKDRDLAATLARLTTVYLADQDRYRTLNELYMAAAH
RPELQRLARLWPDGLLALLEPRIGRRAANAVTVFFDGATLHALITGTPLSTDELTDAIAR
LVADGPEQREVGQSAHAGRTPD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgcaggctccgaccgccgtccacgcgacccagccggtcgccggcaggcgatcgtc
gaggcggccgagcgcgtgatcgctcgccagggccttggcgggctgagccaccgcagggtt
gccgcggaggccaatgtaccggtcgggtcgacgacctactacttcaatgacctcgacgcg
ctgcgggaagccgcgctcgcgcacgccgcaaacgcctcggccgacctgttggcgcagtgg
cgcagcgacctcgacaaggaccgcgacctggccgcgaccctggcccggctcaccaccgtc
tacctggccgaccaggaccgctatcgcacgctcaacgagttgtacatggcggcagctcat
cgaccggaactgcagcgcttggcccggctgtggccagatggtctactcgcgctgctcgaa
ccgcgcatcggtcgacgagccgccaacgcggtcaccgtgtttttcgacggcgctacgctg
cacgcgcttatcaccggtaccccgctgagcaccgatgagctcaccgatgccatcgccagg
ctggttgcggacggcccggaacagcgcgaagtgggacaatctgcccatgcgggacgaacc
cccgactga

DBGET integrated database retrieval system