KEGG   Mycobacterium africanum: MAF_30770Help
Entry
MAF_30770         CDS       T01575                                 

Definition
(GenBank) putative conserved integral membrane protein
  KO
K06199  fluoride exporter
Organism
maf  Mycobacterium africanum
Brite
KEGG Orthology (KO) [BR:maf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:maf02000]
    MAF_30770
Transporters [BR:maf02000]
 Other Transporters
  Pores ion channels [TC:1]
   MAF_30770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CRCB DUF3180 DUF4203
Motif
Other DBs
NCBI-ProteinID: CCC28147
UniProt: F8M5K3
Position
3413081..3413461
Genome map
AA seq 126 aa AA seqDB search
MTASTALTVAIWIGVMLIGGIGSVLRFLVDRSVARRLARTFPYGTLTVNITGAALLGFLA
GLALPKDAALLAGTGFVGAYTTFSTWMLETQRLGEDRQMVSALANIVVSVVLGLAAALLG
QWIAQI
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgacggcctcgacggccctgacggtggcaatctggatcggcgtgatgctcatcggcggt
attgggtccgtgttgcgttttctggtcgatcgctcggtggcccgccggctggcccggact
tttccctacggcacactgacggtgaacatcaccggagccgcgctgctggggtttctggcc
ggcctggcgttgccgaaagacgcagccttactggccggcacggggttcgtcggcgcctac
accaccttttccacctggatgctagaaacccaacggttgggagaggaccgccagatggtt
tcggcattggccaatatcgtcgtcagcgttgtgctcggtctagccgcggcgctactcggt
cagtggatcgcccagatatga

DBGET integrated database retrieval system