KEGG   Mycobacterium africanum: MAF_30850Help
Entry
MAF_30850         CDS       T01575                                 

Gene name
hab
Definition
(GenBank) putative hydroxylaminobenzene mutase HAB
  KO
K01865  (hydroxyamino)benzene mutase [EC:5.4.4.1]
Organism
maf  Mycobacterium africanum
Pathway
maf00627  Aminobenzoate degradation
maf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:maf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MAF_30850 (hab)
Enzymes [BR:maf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.1  (hydroxyamino)benzene mutase
     MAF_30850 (hab)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIG-14_Wnt-bd
Motif
Other DBs
NCBI-ProteinID: CCC28155
UniProt: F8M5L1
Position
3420347..3420748
Genome map
AA seq 133 aa AA seqDB search
MQKLLFTIGLALFLIGLLTGLVIPALKNPRMALSSHLEGVLNGMFLVVLGLLWPHIDLPE
AWQVIAVALIVYSAYANWLATLLAAAWGAGRKFAPIATGDHKAPAAKEGFVSFLLLSLSV
AIVIGVVIVIIGL
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaagctgctattcaccatcgggttggccctgttcctgatcggcctgcttaccgga
ttggtcatcccggcactgaagaacccgcgcatggcgctgtcgagccacctcgagggggtc
ctcaacgggatgttcctcgtcgtgctcggcctgctctggccgcacatcgatctgcccgag
gcatggcaggttatcgcggtggcgctgatcgtttactccgcctacgccaactggctggcg
accctgctcgcggcggcctggggagcgggccgtaaattcgcgcccatcgcgaccggcgac
cacaaagccccggccgccaaggagggattcgtcagctttctgttgttgtccctctcggtg
gccatcgtgatcggcgtggtcatcgtcatcattggcctctga

DBGET integrated database retrieval system