KEGG   Mycobacterium africanum: MAF_30900Help
Entry
MAF_30900         CDS       T01575                                 

Definition
(GenBank) putative monooxygenase (hydroxylase)
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMO-like Pyr_redox_2 K_oxygenase NAD_binding_8 Pyr_redox_3 DAO Thi4 NAD_binding_9 FAD_oxidored MCRA
Motif
Other DBs
NCBI-ProteinID: CCC28160
Position
3427498..3428985
Genome map
AA seq 495 aa AA seqDB search
MNQHFDVLIIGAGLSGIGTACHVTAEFPDKTIALLERRERLGGTWDLFRYPGVRSDSDMF
TFGYKFRPWRDVKVLADGASIRQYIADTATEFGVDEKIHYGLKVNTAEWSSRQCRWTVAG
VHEATGETRTYTCDYLISCTGYYNYDAGYLPDFPGVHRFGGRCVHPQHWPEDLDYSGKKV
VVIGSGATAVTLVPAMAGSNPGSAAHVTMLQRSPSYIFSLPAVDKISEVLGRFLPDRWVY
EFGRRRNIAIQRKLYQACRRWPKLMRRLLLWEVRRRLGRSVDMSNFTPNYLPWDERLCAV
PNGDLFKTLASGAASVVTDQIETFTEKGILCKSGREIEADIIVTATGLNIQMLGGMRLIV
DGAEYQLPEKMTYKGVLLENAPNLAWIIGYTNASWTLKSDIAGAYLCRLLRHMADNGYTV
ATPRDAQDCALDVGMFDQLNSGYVKRGQDIMPRQGSKHPWRVLMHYEKDAKILLEDPIDD
GVLHFAAAAQDHAAA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcatttcgacgtcctgatcatcggcgccggcctatccggcatcgggacggcc
tgtcacgtgacggccgagttccccgacaagacaatcgccctcctggaacgacgggagcgc
ctgggcggcacctgggacttgttccgctacccgggagttcgttcggactccgacatgttc
accttcggctacaagttccgcccgtggcgcgacgtgaaggtgctcgccgacggcgcgtcg
atccggcagtacatcgccgacaccgccacggagttcggcgtcgacgagaagattcactac
ggcctgaaggtcaacaccgccgagtggtcgagccggcagtgccgttggaccgtcgcgggc
gtgcacgaggcgaccggcgaaacccggacctacacctgcgattacctcatcagctgcacc
ggctactacaactacgacgcgggttatctgccggacttccccggcgtgcaccggttcggc
ggccggtgcgtgcacccgcagcactggcccgaagacctcgattattccggcaagaaggtc
gtcgtcatcggcagcggcgcaacggcggtcactttggttccggcgatggccggctccaac
cccggcagtgccgcgcacgtgacgatgctgcagcgatccccgtcgtacatcttctcgctg
ccggcggtcgacaagatctccgaagtcctgggccgcttcctgccggatcgctgggtctac
gagtttggccgcaggcgcaacatcgccatccagcgaaagctctaccaggcctgccggcgc
tggcccaagctgatgcggcgattgctgctgtgggaggtacgacgccgcctcggccgctcc
gtggacatgagcaacttcaccccgaactacctgccgtgggacgagcggttgtgcgccgtg
cccaacggcgatctgtttaagacgctggcctcgggcgcggcgtcggtggtgaccgatcag
atcgagaccttcaccgagaagggcatcctgtgcaagtccggccgggagatcgaggccgac
atcatcgtcaccgcgaccggtctgaacatccagatgctgggcgggatgcgactcatcgtg
gacggcgccgaataccagctgccggagaagatgacctataagggtgtgctgctggaaaac
gcccccaatctggcctggatcatcggctacaccaacgcgtcatggaccctgaagtccgac
atcgccggcgcctacctgtgccggctgctgcggcacatggccgacaacggctacacggtg
gcaacgccgcgcgatgcgcaggactgcgcgctggacgttggcatgttcgaccagctgaac
tccggctatgtgaagcgcggccaggacatcatgccgcgccagggctccaagcatccgtgg
agggtgctcatgcactacgagaaggacgccaagatcctgctcgaagaccccatcgatgac
ggcgtgctgcacttcgccgcagcggcccaagaccacgcggcggcctga

DBGET integrated database retrieval system