KEGG   Mycobacterium africanum: MAF_30960Help
Entry
MAF_30960         CDS       T01575                                 

Gene name
fadD13
Definition
(GenBank) putative chain-fatty-acid-CoA ligase FADD13 (fatty-acyl-CoA synthetase)
Organism
maf  Mycobacterium africanum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CCC28166
Position
3434755..3436266
Genome map
AA seq 503 aa AA seqDB search
MKNIGWMLRQRATVSPRLQAYVEPSTDVRMTYAQMNALANRCADVLTALGIAKGDRVALL
MPNSVEFCCLFYGAAKLGAVAVPINTRLAAPEVSFILSDSGSKVVIYGAPSAPVIDAIRA
QADPPGTVTDWIGADSLAERLRSAAADEPAVECGGDDNLFIMYTSGTTGHPKGVVHTHES
VHSAASSWASTIDVRYRDRLLLPLPMFHVAALTTVIFSAMRGVTLISMPQFDATKVWSLI
VEERVCIGGAVPAILNFMRQVPEFAELDAPDFRYFITGGAPMPEALIKIYAAKNIEVVQG
YALTESCGGGTLLLSEDALRKAGSAGRATMFTDVAVRGDDGVIREHGEGEVVIKSDILLK
EYWNRPEATRDAFDNGWFRTGDIGEIDDEGYLYIKDRLKDMIISGGENVYPAEIESVIIG
VPGVSEVAVIGLPDEKWGEIAAAIVVADQNEVSEQQIVEYCGTRLARYKLPKKVIFAEAI
PRNPTGKILKTVLREQYSATVPK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacattggctggatgctcagacaacgcgcgaccgtctcgccgcggctgcaagcc
tacgtcgagccgtccaccgacgtccggatgacctacgcgcagatgaacgcgctggcgaac
cggtgcgccgacgtgctcaccgcgctggggatcgccaagggcgaccgcgtggcattgctg
atgcccaacagcgtcgagttctgttgcctgttctatggcgcggccaagctcggcgcggta
gcggtccctatcaacacccgcctcgccgcacccgaggtgagtttcatcctgtccgacagc
ggcagcaaggtggtgatctacggtgcgccgtcggcgccggtgatcgacgccatcagggcg
caggccgaccctccgggcacggtcaccgactggataggcgccgactcgttggccgaacgc
ctgaggtcggcggccgcagacgagccggcggtcgaatgcggcggcgatgacaacttgttc
atcatgtacacctcgggcaccaccggacatcccaagggagtggtgcatacccacgaatcg
gtgcattcggcggccagttcctgggcctcgacgatcgacgtgcgctaccgcgaccgcctg
ctgctaccgctgccgatgttccacgtggcggcgttgacgacggtcatcttcagcgccatg
cgcggcgtcacgctgatctcgatgccgcagttcgatgcgacgaaggtgtggtcactgatc
gtcgaggagcgggtctgtatcggtggcgccgtgccggcgatcctcaacttcatgcgccag
gtgcccgagttcgccgaactcgacgcgcccgacttccgctacttcatcaccggtggcgcg
cccatgccggaggccctgatcaagatctatgccgccaagaacatcgaggtcgtgcagggt
tacgcgctcaccgaatcctgtggcggcggcaccctgctgctcagcgaagacgcgctgcgc
aaagccggctcggccggacgcgccaccatgttcaccgacgtggccgtgcgcggtgacgac
ggcgtgatccgcgagcacggcgaaggcgaagtcgtgatcaagtccgacatcctgctcaag
gaatactggaatcgcccggaggccacccgcgacgctttcgacaacggttggttccggacc
ggcgacatcggcgaaatcgatgatgagggctatctttacatcaaggaccggctgaaggac
atgatcatttccggcggcgagaacgtctacccggccgagatcgaaagtgtgatcatcggc
gttcccggggtcagcgaggtggcggtcatcggcttgcccgacgagaagtggggcgagatc
gccgccgccatcgtcgttgccgaccagaacgaggtcagcgagcagcagatcgtcgagtac
tgcggaaccaggctcgcacgctacaagctgcccaagaaggtgatcttcgccgaggccatc
ccccgcaacccgaccggcaagatcctcaaaacggtgctgcgcgaacagtattcggcgacg
gtgccgaagtga

DBGET integrated database retrieval system