KEGG   Mycobacterium africanum: MAF_31070Help
Entry
MAF_31070         CDS       T01575                                 

Gene name
smpB
Definition
(GenBank) putative SSRA-binding protein SMPB
  KO
K03664  SsrA-binding protein
Organism
maf  Mycobacterium africanum
Brite
KEGG Orthology (KO) [BR:maf00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    MAF_31070 (smpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SmpB
Motif
Other DBs
NCBI-ProteinID: CCC28177
UniProt: F8M5N3
Position
complement(3448295..3448777)
Genome map
AA seq 160 aa AA seqDB search
MSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGE
VWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKV
KVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaagtcgtcgcgtggcggccggcagatcgttgccagcaatcgcaaagcccggcac
aactattcgatcatcgaggtgttcgaggccggggttgcgctgcaaggcacggaggtgaag
agcctgcgggaagggcaggcgtcgctggccgattcgttcgccaccatcgacgacggcgaa
gtgtggctgcgcaacgcgcacatcccggaataccggcacggcagctggaccaaccacgag
ccgcgacgcaaccgcaaactgctgttgcatcgccgccagatcgacaccttggtcggcaag
atccgcgaaggcaacttcgccctggtgccgttgtcgctgtatttcgccgaaggcaaggtc
aaggttgagcttgcgctggcccgaggcaagcaagcccgcgacaaacgccaggacatggcc
cgtcgtgatgcccagcgtgaagtgctccgcgagttgggtcggcgcgctaagggcatgacc
tga

DBGET integrated database retrieval system