KEGG   Mycobacterium tuberculosis variant africanum: MAF_35460Help
Entry
MAF_35460         CDS       T01575                                 

Definition
(GenBank) putative 4-hydroxy-2-oxovalerate aldolase (HOA)
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
maf  Mycobacterium tuberculosis variant africanum
Pathway
maf00360  Phenylalanine metabolism
maf00362  Benzoate degradation
maf00621  Dioxin degradation
maf00622  Xylene degradation
maf01100  Metabolic pathways
maf01120  Microbial metabolism in diverse environments
maf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:maf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MAF_35460
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAF_35460
   00622 Xylene degradation
    MAF_35460
   00621 Dioxin degradation
    MAF_35460
Enzymes [BR:maf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     MAF_35460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: CCC28615
Structure
PDB: 

Position
complement(3954404..3955444)
Genome map
AA seq 346 aa AA seqDB search
MTDMWDVRITDTSLRDGSHHKRHQFTKDEVGAIVAALDAAGVPVIEVTHGDGLGGSSFNY
GFSKTPEQELIKLAAATAKEARIAFLMLPGVGTKDDIKEARDNGGSICRIATHCTEADVS
IQHFGLARELGLETVGFLMMAHTIAPEKLAAQARIMADAGCQCVYVVDSAGALVLDGVAD
RVSALVAELGEDAQVGFHGHENLGLGVANSVAAVRAGAKQIDGSCRRFGAGAGNAPVEAL
IGVFDKIGVKTGIDFFDIADAAEDVVRPAMPAECLLDRNALIMGYSGVYSSFLKHAVRQA
ERYGVPASALLHRAGQRKLIGGQEDQLIDIALEIKRELDSGAAVTH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatgtgggacgtccgcatcacggacacctcgctgcgggatgggtcgcaccac
aaacgccaccaattcaccaaggacgaggtcggtgccatcgtggccgccctagacgccgct
ggcgtgccggtgatcgaggtgacccacggcgacggcctgggcggctcatcgttcaactat
ggcttctcgaaaacccctgagcaggagctgatcaagctggccgcggcgaccgcgaaagag
gcccggatcgcgtttttgatgttgcccggtgtgggcaccaaggacgacatcaaagaggcg
cgggacaacggcgggtcgatctgccggatcgccacccactgcaccgaggccgacgtgtcg
atccagcatttcgggctggcccgcgaactgggtctggaaaccgtcgggtttttgatgatg
gcccacaccattgcgccggagaaactggccgcccaggcccgcatcatggccgacgccggc
tgccagtgtgtctacgtcgtcgactccgccggtgccctggtgctcgacggcgtggccgac
cgggtgtcggccctggtcgccgagctcggcgaagacgcccaggtgggctttcatgggcac
gagaacctcggtctcggggtggccaattcggtggcggcggtgcgcgcgggcgccaagcag
atcgacgggtcctgccggcgtttcggcgccggggcgggtaacgcgccggtcgaggcgctg
atcggggtgttcgacaagatcggcgtcaagaccggcattgatttcttcgacattgccgac
gccgccgaggacgtggtgcgcccggccatgccggccgaatgtctgctcgaccgcaacgcg
ttgatcatggggtattccggggtctactccagcttcctcaagcatgcggtccgccaggcc
gagcgctacggcgtgccggcgtcggcgctgttgcaccgggccggtcagcgcaagctcatc
ggtggccaggaagaccagctcatcgacatcgcgctggaaatcaaacgcgagctggatagc
ggtgcggccgtaacgcattga

DBGET integrated database retrieval system