KEGG   Mycobacterium africanum: MAF_35680Help
Entry
MAF_35680         CDS       T01575                                 

Gene name
fadA6
Definition
(GenBank) putative acetyl-CoA acetyltransferase FADA6 (acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
maf  Mycobacterium africanum
Pathway
maf00071  Fatty acid degradation
maf00072  Synthesis and degradation of ketone bodies
maf00280  Valine, leucine and isoleucine degradation
maf00310  Lysine degradation
maf00362  Benzoate degradation
maf00380  Tryptophan metabolism
maf00620  Pyruvate metabolism
maf00630  Glyoxylate and dicarboxylate metabolism
maf00640  Propanoate metabolism
maf00650  Butanoate metabolism
maf00900  Terpenoid backbone biosynthesis
maf01100  Metabolic pathways
maf01110  Biosynthesis of secondary metabolites
maf01120  Microbial metabolism in diverse environments
maf01130  Biosynthesis of antibiotics
maf01200  Carbon metabolism
maf01212  Fatty acid metabolism
maf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:maf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAF_35680 (fadA6)
   00630 Glyoxylate and dicarboxylate metabolism
    MAF_35680 (fadA6)
   00640 Propanoate metabolism
    MAF_35680 (fadA6)
   00650 Butanoate metabolism
    MAF_35680 (fadA6)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MAF_35680 (fadA6)
   00072 Synthesis and degradation of ketone bodies
    MAF_35680 (fadA6)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAF_35680 (fadA6)
   00310 Lysine degradation
    MAF_35680 (fadA6)
   00380 Tryptophan metabolism
    MAF_35680 (fadA6)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAF_35680 (fadA6)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAF_35680 (fadA6)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MAF_35680 (fadA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:maf04147]
    MAF_35680 (fadA6)
Enzymes [BR:maf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MAF_35680 (fadA6)
Exosome [BR:maf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAF_35680 (fadA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCC28637
UniProt: F8M8C6
Position
complement(3977656..3978816)
Genome map
AA seq 386 aa AA seqDB search
MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIG
GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMS
QIPISSAMTVGEQFGFTSPTNESKQWLHRYGDQEISQFRGSELIAEKWNLSREEMERYSL
TSHERAFAAIRAGHFENEIITVETESGPFRVDEGPRESSLEKMAGLQPLVEGGRLTAAMA
SQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLTGPIPATRYALDKTGLA
IDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPLGATGAKLFTTMLGELE
RIGGRYGLQTMCEGGGTANVTIIERL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggcgtacgtcatcgacgccgtacggaccgcggtcggcaagcggggcggcgca
ctggccggtatccatcccgtcgacctgggtgccctggcctggcgcggactgctggaccgg
accgacatcgaccccgccgccgtcgacgacgtgatcgccggatgtgtcgacgccatcggc
ggacaggcgggcaacatcgcccgactgtcgtggctggccgccggctatcccgaagaggtc
cccggtgtcaccgtggaccgccagtgcggatccagccagcaggcgatttcctttggcgcg
caggcgatcatgtccggcacggcggatgtcatcgtggccggcggcgtgcagaacatgagc
cagatcccgatctcgtcggcgatgaccgtgggcgaacagttcgggttcacctcgccgacc
aacgaatccaagcaatggttacaccggtatggcgaccaggagatttcacagttccgtggc
tcggagctgatcgccgagaagtggaacctgtcccgtgaagagatggagcggtactcgctg
accagccacgaacgcgcgttcgcggcgatccgcgccggccacttcgaaaacgaaatcatc
actgtggaaaccgaatccgggccgttccgggttgatgagggcccgcgggagtcgtcgctg
gagaagatggccggcttgcagccgctggtcgagggcggccggctgacggcggcgatggcc
agtcagatctccgacggcgccagtgcagtgttgctggcctccgagcgggccgtcaaagac
catggacttaggccccgtgcccgcatccaccacatcagtgcgcgcgccgccgacccggta
ttcatgctgaccggacccatccccgccacccggtacgcgctggacaagaccgggcttgcc
atcgacgacatcgacaccgtcgagatcaacgaggcgttcgcgccggtagttatggcctgg
ctcaaggaaatcaaggccgacccggcgaaggtcaaccccaacggcggcgcgatcgcgctg
gggcatccgctaggcgccaccggcgccaaactgttcaccaccatgctgggcgagctggag
cgcatcggtggccgctacgggctgcagaccatgtgcgagggcggcggcaccgccaacgtc
accattatcgagcggctgtag

DBGET integrated database retrieval system