KEGG   Mycobacterium africanum: MAF_37890Help
Entry
MAF_37890         CDS       T01575                                 

Gene name
echA21
Definition
(GenBank) putative enoyl-CoA hydratase EchA21
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
maf  Mycobacterium africanum
Pathway
maf00071  Fatty acid degradation
maf00280  Valine, leucine and isoleucine degradation
maf00281  Geraniol degradation
maf00310  Lysine degradation
maf00360  Phenylalanine metabolism
maf00362  Benzoate degradation
maf00380  Tryptophan metabolism
maf00410  beta-Alanine metabolism
maf00627  Aminobenzoate degradation
maf00640  Propanoate metabolism
maf00650  Butanoate metabolism
maf00903  Limonene and pinene degradation
maf00930  Caprolactam degradation
maf01100  Metabolic pathways
maf01110  Biosynthesis of secondary metabolites
maf01120  Microbial metabolism in diverse environments
maf01130  Biosynthesis of antibiotics
maf01212  Fatty acid metabolism
Module
maf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAF_37890 (echA21)
   00650 Butanoate metabolism
    MAF_37890 (echA21)
  Lipid metabolism
   00071 Fatty acid degradation
    MAF_37890 (echA21)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAF_37890 (echA21)
   00310 Lysine degradation
    MAF_37890 (echA21)
   00360 Phenylalanine metabolism
    MAF_37890 (echA21)
   00380 Tryptophan metabolism
    MAF_37890 (echA21)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAF_37890 (echA21)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAF_37890 (echA21)
   00281 Geraniol degradation
    MAF_37890 (echA21)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAF_37890 (echA21)
   00627 Aminobenzoate degradation
    MAF_37890 (echA21)
   00930 Caprolactam degradation
    MAF_37890 (echA21)
Enzymes [BR:maf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAF_37890 (echA21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCC28858
UniProt: F8M9N1
Position
4196401..4197225
Genome map
AA seq 274 aa AA seqDB search
MGETYESVTVETKDQVAQVTLIGPGKGNAMGPAFWSEMPEVFHALDADREVRAIVITGSG
KNFSYGLDVPAMGGMFAPLIADGALARPRTDFHTEILRMQKAINAVADCRTPTIAAVQGW
CIGGAVDLISAVDIRYASADAKFSVREVKLAIVADMGSLARLPLILSDGHLRELALTGKN
IDAARAEKIGLVNDVYDDADQTLAAAHATAAEIAANPPLAVYGIKDVLDQQRTSAVSENL
RYVAAWNAAFLPSKDLTEGISATFAKRPPQFTGE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaacctacgaatccgtcaccgtcgaaaccaaggaccaggtcgcgcaggtgacg
ctgatcgggccgggcaagggcaacgcgatggggcccgcattctggtcggagatgcccgag
gtgttccatgccctggacgccgaccgtgaggtgcgggccatcgtcatcaccggatcgggc
aagaacttcagctacggcctggacgtaccggccatgggcggaatgttcgccccgttgatc
gccgacggcgcgctggcccgcccacgcacggacttccacaccgaaatactgcgcatgcag
aaggcgatcaacgccgtcgccgactgccgcacccccacgatcgcggccgtccagggttgg
tgcatcggcggcgccgtcgacctgatctccgcggtcgacatccggtatgccagcgccgac
gcgaagttctcggtgcgcgaggtcaagctagcgattgttgccgacatgggcagcctggcg
cgccttccactaatcctgagcgacggccatctacgagaactcgcgctgaccggcaaaaat
atcgacgcggcccgcgccgagaagatcggcctggtcaacgacgtctacgatgacgccgac
cagacgctggccgcggcccacgcgactgccgccgagatcgccgccaacccacctttggcg
gtctacggcatcaaggacgttctcgaccaacaacgcacgtccgccgtctcggagaacctg
cgctatgtcgccgcctggaacgccgcgtttctgccgtccaaggacctcaccgaaggtatt
tccgcgacgttcgccaagcgcccgccccagttcaccggcgagtag

DBGET integrated database retrieval system