KEGG   Magnetospirillum magneticum: amb0139Help
Entry
amb0139           CDS       T00305                                 

Definition
(GenBank) Nucleoside-diphosphate-sugar epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00520  Amino sugar and nucleotide sugar metabolism
mag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    amb0139
Enzymes [BR:mag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     amb0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: BAE48943
UniProt: Q2WB32
Position
complement(159690..160751)
Genome map
AA seq 353 aa AA seqDB search
MAEFLLKSDIAEICERLGDTAQDFAGKTVLLTGGRGFLGRYFMEIFAHLNQHILKKPVKL
VAADNLITAGKEGANVAEYPHTEFIQHDVIQPLKWKGSLDYVIHAAGIASPFYYRAHPLA
TLEVAITGTRRMLELAQEHNARFTFFSSSEIYGDPDPKHVPTPESYRGHVSCQGPRACYD
ESKRVGETLCYIFHGEHGTKTNTIRPFNVFGPGMQETDYRVLPNFANRIKGGHPLNVYGS
GNQTRTFCYITDAMVGFLLVILRGVPGEAYNIGNPKPEISMVDLVNRISEVIGKPVAHNV
IEYPDSYPADEPNRRCPDIRKAKLQLKFEPSVDLNEGLRRFLTWADGVYTGEQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtttctgctgaagtccgatatcgctgaaatctgcgagcgcctgggcgacacc
gcccaggacttcgccggcaaaaccgtgctgctgactggcggtcgcggctttcttggccgc
tatttcatggagatcttcgcccatctcaaccagcacatcctgaagaagccggttaagctg
gtcgccgccgacaacctgatcacggcgggcaaggaaggcgccaatgtcgccgagtatcct
cacaccgagttcatccagcacgacgtcattcagccgctgaagtggaagggctcgctcgac
tacgtcatccatgcggccggtatcgccagcccgttctattaccgtgcccatccgctggcg
acgctggaagtggccatcaccggcacgcgccgcatgctggaactggctcaggagcacaac
gcccgcttcaccttcttctcgtcctccgagatttacggcgacccggaccccaagcacgtc
cccaccccggaaagctatcgcggccatgtgtcgtgccagggaccgcgggcctgctatgac
gagtccaagcgcgtcggcgagacgctgtgctacatcttccacggcgagcacggcaccaag
accaacaccatccgcccgttcaacgtcttcggccctggcatgcaggagaccgactaccgg
gtgctgcctaatttcgccaaccgcatcaagggcggccatccgctcaacgtctacggctcg
ggcaaccagacgcggaccttctgctacatcaccgacgccatggtcggcttcctgctggtc
atcctgcgcggcgtgcctggcgaggcctacaatatcggcaatcccaagccggaaatctcc
atggtcgatctggtcaaccgcatttccgaggtgatcggcaagccggtggcccacaatgtg
atcgagtatccggattcctatcccgccgacgagcccaaccgccgctgccccgacattcgc
aaggccaagctgcagctcaaattcgagcccagcgtcgacctcaacgaaggcctgcgccgc
ttcctgacctgggccgacggtgtctataccggcgagcagtga

DBGET integrated database retrieval system