KEGG   Magnetospirillum magneticum: amb0634Help
Entry
amb0634           CDS       T00305                                 

Definition
(GenBank) Enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00071  Fatty acid degradation
mag00280  Valine, leucine and isoleucine degradation
mag00281  Geraniol degradation
mag00310  Lysine degradation
mag00360  Phenylalanine metabolism
mag00362  Benzoate degradation
mag00380  Tryptophan metabolism
mag00410  beta-Alanine metabolism
mag00627  Aminobenzoate degradation
mag00640  Propanoate metabolism
mag00650  Butanoate metabolism
mag00903  Limonene and pinene degradation
mag00930  Caprolactam degradation
mag01100  Metabolic pathways
mag01110  Biosynthesis of secondary metabolites
mag01120  Microbial metabolism in diverse environments
mag01130  Biosynthesis of antibiotics
mag01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    amb0634
   00650 Butanoate metabolism
    amb0634
  Lipid metabolism
   00071 Fatty acid degradation
    amb0634
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    amb0634
   00310 Lysine degradation
    amb0634
   00360 Phenylalanine metabolism
    amb0634
   00380 Tryptophan metabolism
    amb0634
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    amb0634
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    amb0634
   00281 Geraniol degradation
    amb0634
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    amb0634
   00627 Aminobenzoate degradation
    amb0634
   00930 Caprolactam degradation
    amb0634
Enzymes [BR:mag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     amb0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAE49438
UniProt: Q2W9N7
Position
682180..682956
Genome map
AA seq 258 aa AA seqDB search
MAFENITVETRGNVGVIALNRPKAMNALCAALISELGQALDAFEADDSIGAVVLTGSEKA
FAAGADIKEMASKSYMDVYLANFITDGWERVTKCRKPIVAAVAGFALGGGCEMAMMCDFI
IAGDNAKFGQPEITIGTIPGAGGTQRLTRAVGKSKAMEMCLTGRMMDAAEAERAGLVSRI
VPVAELLDEAVKAAGKIASLSRPIVMLCKESVNAAFETTLAQGVTFERRLFHSTFSTEDQ
KEGMAAFVEKRPAAFKNR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgagaacatcaccgtcgagacccgcggcaatgtcggcgtgattgccctgaac
cggcccaaggccatgaacgcgctctgcgccgccctgatttccgagctgggccaggcgctg
gacgccttcgaggccgacgattccatcggcgccgtggtgctgaccggttcggaaaaggcc
ttcgcggccggtgccgacatcaaggaaatggcgtccaagagctacatggacgtctatctc
gccaacttcatcaccgacggctgggagcgtgtcaccaagtgccgcaagcccatcgtggcg
gcggtggccggctttgccctgggcggcggctgcgagatggccatgatgtgcgacttcatc
atcgccggcgacaatgccaagttcggccagcccgagatcaccatcggcaccatccccggc
gcgggcggcacccagcgcctgacccgcgccgtgggcaagtccaaggccatggagatgtgc
cttaccggccgcatgatggacgccgccgaggccgagcgcgccggcctggtcagccgcatc
gtgccggtggccgagctgctggacgaggccgtcaaggccgccggcaagatcgcctcgctg
tcgcggcccatcgtcatgctgtgcaaggaatcggtcaacgccgccttcgagaccaccctg
gcccagggcgtcaccttcgagcgccgcctgttccattccaccttctccaccgaggatcag
aaggaaggcatggccgccttcgtcgaaaagcgccccgccgctttcaagaaccgttga

DBGET integrated database retrieval system