KEGG   Magnetospirillum magneticum: amb1259Help
Entry
amb1259           CDS       T00305                                 

Definition
(GenBank) Cytochrome C2
  KO
K08738  cytochrome c
Organism
mag  Magnetospirillum magneticum
Pathway
mag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mag00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    amb1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: BAE50063
UniProt: Q2W7W2
Position
complement(1341574..1341939)
Genome map
AA seq 121 aa AA seqDB search
MLNTKKLGLVLGAALLAAPFAASAADAPAAFNQCKACHKVEAGKHGVGPSLFGVYGAKAG
HAEGYKYSDNHVKSGMVWDDANLGKYLADPKATIPGNKMAFAGLKKPEDVAAVVAYLKTL
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacaccaagaagctgggcctcgtcctcggagccgccctcctcgctgccccgttc
gccgcctctgccgccgatgccccggccgctttcaaccagtgcaaggcctgtcacaaggtc
gaagccggcaagcacggcgtcggccccagcctgttcggcgtctacggcgccaaggccggc
cacgccgagggctacaagtattccgacaaccacgtgaagtcgggcatggtctgggacgat
gccaacctgggcaagtacctggccgaccccaaggccaccattcccggcaacaagatggcc
ttcgccggcctgaagaagcccgaggacgtggccgccgtggtcgcctatctgaagaccctg
aagtaa

DBGET integrated database retrieval system