KEGG   Magnetospirillum magneticum: amb2139Help
Entry
amb2139           CDS       T00305                                 

Definition
(GenBank) Activator of 2-hydroxyglutaryl-CoA dehydratase
  KO
K04114  benzoyl-CoA reductase subunit A [EC:1.3.7.8]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00362  Benzoate degradation
mag01100  Metabolic pathways
mag01120  Microbial metabolism in diverse environments
mag01220  Degradation of aromatic compounds
Module
mag_M00541  Benzoyl-CoA degradation, benzoyl-CoA => 3-hydroxypimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:mag00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    amb2139
Enzymes [BR:mag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.8  benzoyl-CoA reductase
     amb2139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BcrAD_BadFG FGGY_N FtsA
Motif
Other DBs
NCBI-ProteinID: BAE50943
UniProt: Q2W5D2
Position
complement(2314769..2316061)
Genome map
AA seq 430 aa AA seqDB search
MRCFIGIDLGSTTTKAVVMDENLQILGRGITNSRSNYDTAAAVSKQEALIDTRLTLFRRA
LSNVPEVSGKVDDILSDLERNFRHVQFLEQLEDLQNTCIANIKGPRFAGREKVVIEALEG
TFSRLRDSSAAQYAPGVKRKSDFFRDLAGAEFMSHGEAVCKEAGLGFDLILNVYDKSIIE
VENRPPAGDMEGKFVRALEKGTMTGSSILAPVQSALAIPLEETYVVGTGYGRVRLPFPKE
HIRSEILCHGLGAHMMYPDTRTVLDIGGQDTKGIQVDPVGIVENFQMNDRCAAGCGRYLG
YIADEMNMGLHELGPLAMKSNKQVRINSTCTVFAGAELRDRLALGEKREDILAGLHRAII
LRAMSILSRAGGVKDQFTFTGGVAKNEAAVRELRKLIKENYGDVTINIDPDSIYTGALGG
ATFAVRAVVN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgtttcatcggtatcgatctgggctccaccaccaccaaagccgtggtgatggat
gagaacctccagatcctgggacgcggcatcaccaattcgcgctccaactacgacaccgcg
gccgccgtttccaagcaggaagcgctgatcgacacccgcctgaccctgttccgccgcgct
ctgtcgaacgtgccggaagtgtcgggcaaggtcgacgacatcctgtcggatctggagcgg
aacttccgtcacgtccagttcctggagcagttggaagacctgcagaacacctgcatcgcc
aacatcaaggggccgcgcttcgccggccgcgagaaggtggtgatcgaggccctggaaggc
accttctcccgcctgcgtgacagctcggccgcccagtacgcgccgggcgtcaagcgcaag
tccgacttcttccgcgatctggccggcgccgagttcatgagccacggcgaggcggtgtgc
aaggaggccggtctcggcttcgacctgatcctcaacgtctacgacaagtcgatcatcgaa
gtggaaaaccgtccgccggccggcgacatggagggcaagttcgtccgcgccctggaaaag
ggcaccatgaccgggtcctcgatcctggccccggtgcagtcggccctggccattccgctg
gaggagacttacgtggtcggcaccggctacggccgcgtccgcctgcccttccccaaggag
cacatccgctcggagatcctgtgccacggcctgggcgcccacatgatgtacccggacacc
cgcacggtgctggacatcggcggccaggacaccaagggcatccaggtggacccggtgggc
atcgtcgagaacttccagatgaacgatcgttgcgccgccggttgcggccgttatctgggc
tacatcgccgacgagatgaacatgggcctgcacgagctcggcccgctggccatgaagtcc
aacaagcaggttcgaatcaactccacctgcaccgtgttcgcgggcgccgagttgcgtgac
cgtctggccctgggcgaaaagcgcgaggacattctggccggtctgcaccgcgccatcatc
ctgcgcgccatgtccatcctgtcgcgcgccggcggcgtcaaggaccagttcaccttcacc
ggtggcgtcgccaagaacgaggcggcggtgcgcgagctgcgcaagctgatcaaggaaaac
tacggcgacgtgaccatcaacatcgacccggactcgatctacaccggcgctctcggcggg
gccaccttcgccgtccgcgcggtcgtcaactaa

DBGET integrated database retrieval system