KEGG   Magnetospirillum magneticum: amb2318Help
Entry
amb2318           CDS       T00305                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzyme
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00010  Glycolysis / Gluconeogenesis
mag00020  Citrate cycle (TCA cycle)
mag00620  Pyruvate metabolism
mag01100  Metabolic pathways
mag01110  Biosynthesis of secondary metabolites
mag01120  Microbial metabolism in diverse environments
mag01130  Biosynthesis of antibiotics
mag01200  Carbon metabolism
Module
mag_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    amb2318
   00020 Citrate cycle (TCA cycle)
    amb2318
   00620 Pyruvate metabolism
    amb2318
Enzymes [BR:mag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     amb2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: BAE51122
UniProt: Q2W4V3
Position
2521604..2522887
Genome map
AA seq 427 aa AA seqDB search
MPVQILMPALSPTMTEGNLAKWLKNEGDAVKSGDILCEIETDKATMEFEAVDEGVLGKIL
VAGGTSGVAVNTPIAVLLEEGEDASAISAISAISAAPAPKAAAPAAAAAPVTAAAPVAAP
SGPAHGGDRVVASPLAKRIAKDGNVDLKAVKGSGPHGRIVKADVEAAIKAGPAKPAAAPA
AIVAPAAKSAPAPAAASPFEPAFEEIPNSSMRKVIARRLTEAKSTIPHFYLSIDCELDAL
LKVRADLNGRSDAYKLSVNDFVVRAVALALKKAPAANASWGEEAIKRYTDIDISVAVATP
SGLITPIVHHADHKGLAEISNEMKSLAAKARDGKLKPEEFQGGGFTISNLGMFGIKEFAA
IINPPQGCILAVGAGEQRPVVKAGALAVATVMTCTLSVDHRVVDGAVGAEFLAAFKKLIE
DPLSMLL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttcaaatcctgatgcccgccctctcgccgaccatgaccgagggcaatctggcc
aagtggctgaagaacgagggtgacgccgtcaagtccggcgacatcctctgcgagatcgag
accgacaaggcgaccatggagttcgaggccgtcgacgaaggcgtgctcggcaagattctg
gtggccggcggcacctccggcgtggcggtcaacacgcccattgccgtgctgctggaagaa
ggcgaggatgcctcggccatctcggccatctcggccatctcggccgctccggcgcccaag
gcggccgctcccgccgccgctgcggcgccagttactgccgctgctccggttgccgcaccg
tcagggccggcccatggcggcgaccgtgtcgtcgcctcgcccctggccaagcgcatcgcc
aaggacggcaatgtggacctgaaggcggtgaagggctccggcccccacggccgcatcgtc
aaggccgacgtggaagccgccatcaaggccggtcccgccaagcccgccgccgccccggct
gcaattgtcgctccggcggccaagtccgcgccggcccccgccgccgccagtccgttcgag
ccggccttcgaggagattcccaactcctccatgcgcaaggtcatcgcccggcgcctgacc
gaggccaagtcgaccattccgcacttctatctcagcatcgattgcgagctggacgccctg
ctaaaggtgcgggccgacctcaacggccgttccgatgcctacaagctgtcggtcaacgac
ttcgtggtgcgtgccgtggccctggccctgaagaaggcgcccgccgccaacgcgtcgtgg
ggcgaggaggccatcaagcgctacaccgacattgacatctcggtggcggtggcgacgccg
tccggcctgatcacccccatcgtgcatcacgccgatcacaaggggctggccgaaatctcc
aacgagatgaagtccctggccgccaaggcccgtgacggcaagctgaagcccgaggagttc
cagggcggcggcttcaccatctccaatctcggcatgttcgggatcaaggagttcgccgcc
atcatcaatccgccccagggttgcatcctggcggtgggcgccggcgagcagcgtccggtg
gtcaaggccggtgccctggctgtggccacggtgatgacctgcaccctgtcggtggatcac
cgggttgtcgacggcgcggtgggggccgagttcctggcggccttcaagaagctgatcgaa
gacccgctgtccatgctgctgtag

DBGET integrated database retrieval system