KEGG   Magnetospirillum magneticum: amb2595Help
Entry
amb2595           CDS       T00305                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00071  Fatty acid degradation
mag00072  Synthesis and degradation of ketone bodies
mag00280  Valine, leucine and isoleucine degradation
mag00310  Lysine degradation
mag00362  Benzoate degradation
mag00380  Tryptophan metabolism
mag00620  Pyruvate metabolism
mag00630  Glyoxylate and dicarboxylate metabolism
mag00640  Propanoate metabolism
mag00650  Butanoate metabolism
mag00900  Terpenoid backbone biosynthesis
mag01100  Metabolic pathways
mag01110  Biosynthesis of secondary metabolites
mag01120  Microbial metabolism in diverse environments
mag01130  Biosynthesis of antibiotics
mag01200  Carbon metabolism
mag01212  Fatty acid metabolism
mag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    amb2595
   00630 Glyoxylate and dicarboxylate metabolism
    amb2595
   00640 Propanoate metabolism
    amb2595
   00650 Butanoate metabolism
    amb2595
  09103 Lipid metabolism
   00071 Fatty acid degradation
    amb2595
   00072 Synthesis and degradation of ketone bodies
    amb2595
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    amb2595
   00310 Lysine degradation
    amb2595
   00380 Tryptophan metabolism
    amb2595
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    amb2595
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    amb2595
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    amb2595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mag04147]
    amb2595
Enzymes [BR:mag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     amb2595
Exosome [BR:mag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   amb2595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAE51399
UniProt: Q2W426
Position
complement(2781078..2782274)
Genome map
AA seq 398 aa AA seqDB search
MLDAYIYDGLRSPIGRHGGGLAPVRSDDLAAEVIRALVARSSFKPEDVEDVILGCTNQAG
EDSRNVARHAALLAGLPVEVAGQTVNRLCASGLAAVLDAARSVTCGEGDLYLAGGVESMT
RAPFVLAKGDSAWSRDARIFDTTIGARFANPKVVKSFGGHSMPETADNIAHDLGLSREAS
DAFAAASQAKYAKAKAEGFYEGEIHPITIAGRKGDTIVAEDEHPRPQTDLAALTKLKPLF
EGGVVTAGNASGINDGAAALFIGSRAAGEKAGIAPIARIVAGAAAGVPPRVMGLGPVPAI
TKALARAKLSLKDLDLIEINEAFAVQVLGCVTQLGVAADDSRLNPNGGAIAIGHPLGCSG
ARLALTAARQLQRTGGRHAVVSLCIGVGHGLAAVIERV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgcctatatctacgacggcctgcgttcccccatcggccgccatggcggcggc
ctcgccccggtgcgttccgacgatctggccgccgaggtgatccgcgccctggtggcccgc
tcatcgttcaagcccgaagatgtcgaggacgtgattctcggctgcaccaaccaggcgggc
gaggacagccgcaacgtggcccgtcatgccgccttgctggccggtctgccggtggaggtg
gcgggccagaccgtcaaccgcctgtgcgcctcgggactggccgccgtgctggacgcggcg
cgttcggtgacctgcggcgagggtgacctgtatctggccggcggtgtcgagagcatgacc
cgcgcccccttcgtgctggccaagggcgacagcgcctggtcccgcgatgccaggatcttc
gacaccaccatcggggcgcgtttcgccaatcccaaggtggtgaagtccttcggcggccat
tccatgccggagaccgccgacaacatcgcccatgacctgggcctgtcgcgcgaagcctcg
gatgccttcgccgccgcctcccaggccaagtacgccaaggccaaggccgaaggcttctac
gagggcgagatccaccccatcaccatcgccggccgcaagggcgacaccatcgtggccgag
gacgagcatccgcgtccccagaccgatcttgccgcgctgaccaagctgaagcctttgttc
gagggcggcgtggtcaccgccggcaatgcgtcgggcatcaatgacggcgctgcggcgctg
ttcatcggctcccgcgccgccggcgagaaggcggggatcgcccccatcgcccgcatcgtc
gccggcgcggcggccggcgtgccgccgcgtgtcatgggcctggggccggttcccgccatc
accaaggccctggcgcgggccaagctttccctcaaggacctcgacctcatcgagatcaac
gaggccttcgccgtgcaggtgctgggttgcgtcacccaactgggcgtggccgccgatgat
tcccgcctcaatcccaatggcggcgccatcgccatcggccatccgctgggctgctccggt
gcccgtctggcgctgacggcggcgcggcagttgcagcggaccggcgggcgccatgccgtg
gtctccttgtgcatcggcgtcggccacggcctcgccgccgtgatcgaaagggtctga

DBGET integrated database retrieval system