KEGG   Magnetospirillum magneticum: amb3109
Entry
amb3109           CDS       T00305                                 
Name
(GenBank) Ribosomal protein S11
  KO
K02948  small subunit ribosomal protein S11
Organism
mag  Magnetospirillum magneticum
Pathway
mag03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mag00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    amb3109
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mag03011]
    amb3109
Ribosome [BR:mag03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    amb3109
  Bacteria
    amb3109
  Archaea
    amb3109
SSDB
Motif
Pfam: Ribosomal_S11
Other DBs
NCBI-ProteinID: BAE51913
UniProt: Q2W2L2
Position
complement(3364634..3365029)
AA seq 131 aa
MAKPAAAARPRRRERKNITSGVAHVNATFNNTMITITDAQGNTISWSSAGMQGFKGSRKS
TPYAAQVAAEDAGRKASEHGMRTLEVEVKGPGAGRESALRALQAVGFQITSIRDVTPIPH
NGCRPRKRRRV
NT seq 396 nt   +upstreamnt  +downstreamnt
atggctaagcccgctgctgccgcgcgtccccgtcgccgcgagcgcaagaacatcacctcg
ggcgtggcgcatgtgaatgccacgttcaacaacaccatgatcaccatcaccgatgcccag
ggtaataccatttcctggtcgtcggccggcatgcagggcttcaagggctcgcgcaagtcg
accccgtacgctgcccaggtggctgccgaagacgcgggccgcaaggcgtccgagcacggc
atgcgcaccttggaggtcgaggtgaagggtccgggcgctggccgtgaatcggctctgcgc
gctttgcaggccgtgggcttccagatcacttcgatccgtgacgttacgccgatcccgcac
aacgggtgccggccgcgcaagcgtcgtcgcgtctga

DBGET integrated database retrieval system