KEGG   Magnetospirillum magneticum: amb3186Help
Entry
amb3186           CDS       T00305                                 

Definition
(GenBank) Pseudouridylate synthase, 23S RNA-specific
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
mag  Magnetospirillum magneticum
Brite
KEGG Orthology (KO) [BR:mag00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mag03009]
    amb3186
Enzymes [BR:mag01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     amb3186
Ribosome biogenesis [BR:mag03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    amb3186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: BAE51990
UniProt: Q2W2D5
Position
3450154..3451671
Genome map
AA seq 505 aa AA seqDB search
MPSASSRLQAGMTRVTVTMRRPVPISRPQPSDGQAASAALAMEAICSAKRTSMPPLPASL
PDGRFGGQDKAARHLAETGIKHHNPFGPAARQAQHDPIASYHHLLDPGAGGNGDRQLAEF
GNRRRADPAGDGRRRSLPRRFAVKPIAKDAQAGQQQNPQEQHQSLDRSHDLRFNPCSSMD
MPVTQRLTPPAVEPEEAGTRLDRWLALRLPELSRTRIKGLMEDGRVSLEETTISDASLRV
KPGQCFVVDVPPDAPAQPEPQDIALTVVYEDEDLIVIDKPAGMVVHPAPGNPDETLVNAL
LAHCGESLAGIGGVKRPGIVHRIDKDTSGLLVAAKTDAAHRGLATQFAAHTLERAYWALV
WGTPSPRQGEIEGNIGRNPNDRKKMAVVKSGGKPALTRYRVLKSFAGGAVSLVECRLATG
RTHQIRVHMTTQGHPLVGDPVYGRIRGHKGVVLPPEVKTALIQFPRQALHAYLLGFSHPT
KGYDVRFESGMPLDINALMQILEVL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
ttgccttcggcctcgagcagattgcaggccggcatgacccgcgtgacggtcacgatgcgc
cgccccgtgccgatcagcaggccgcagccttccgacggccaggcggcttcggccgcgctg
gcgatggaggccatctgttccgccaagaggaccagcatgccgcccctccccgcctcgcta
ccggacggccggttcgggggtcaggacaaagccgcccgccaccttgccgagaccgggatc
aagcaccacaatccgttcgggcccgccgccagacaggcgcagcacgacccgatcgccagc
taccaccatctgctcgaccctggcgccggcgggaatggggaccgccagttggccgaattc
ggcaaccgaaggcgcgccgacccggctggcgatggccgaaggcgttcccttccccggcgc
tttgctgtaaagcccatagccaaggacgcccaagccggccagcagcagaacccccaggaa
cagcaccaatcccttgatcgctctcatgatcttcgcttcaatccctgttcgtccatggac
atgcccgtgacccagcgcctgaccccgcccgccgtcgagcccgaggaggccggcacccgc
ctggaccgttggctggctctgcgcctgcccgaactgtcacgcacccgcatcaaagggctg
atggaggacggacgggtcagcctggaggagacgaccatatccgacgcctccctcagggtc
aaacccggccagtgcttcgtggtggacgtcccccccgacgctccggcccagcccgagccc
caggacatcgccctgaccgtggtctacgaggacgaggatctgatcgtcatcgacaagccg
gccggcatggtggtccatcccgcgccgggcaatcccgacgagaccctggtcaatgccctg
ctggcccattgcggcgaatccctggccggcatcggcggcgtgaagcgacccggcatcgtc
caccgcatcgacaaggacaccagcggcctgctggtcgccgccaagaccgacgcggcccac
cgcgggctggcgacccagttcgccgcgcacaccctggagcgcgcctattgggccctggtc
tggggcacccccagcccccgacagggcgagatcgagggcaatatcggccgcaaccccaac
gaccgcaagaagatggcggtggtgaaaagcggcggcaagccggccctgacccgctaccgc
gtgctcaaaagcttcgccggcggcgccgtcagcctggtggaatgccgcctggccaccgga
cgcacccaccagattcgcgtccatatgaccacgcagggccatcccctggtcggcgatccg
gtctatggcaggattcgtggccacaaaggagtggtcctaccacctgaggtgaagaccgca
ctgatccaattcccgcgccaggcccttcatgcctacctactcggtttttcgcatcctact
aaaggatatgacgtccgcttcgaaagcggtatgccacttgatatcaacgcattgatgcag
attttagaggttctataa

DBGET integrated database retrieval system