KEGG   Magnetospirillum magneticum: amb3874Help
Entry
amb3874           CDS       T00305                                 

Definition
(GenBank) Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00300  Lysine biosynthesis
mag01100  Metabolic pathways
mag01120  Microbial metabolism in diverse environments
mag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    amb3874
Enzymes [BR:mag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     amb3874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: BAE52678
UniProt: Q2W0E7
Position
4280650..4281789
Genome map
AA seq 379 aa AA seqDB search
MSFRDPVPLAQALIRCPSVTPEDAGALDVLAGALEELGFACHHIRSATGGPEIRNLYARL
GTEAPNLCFAGHTDVVPPGKGWTVEPFAAGIDQGRLFGRGSADMKGAIACFVAAVARLLE
DGAPKGSLSLLITGDEEGPAVDGTVKVLDWLAARGERIDCCIVGEPTNPRKLGDMMKIGR
RGSLNCRLTVFGTQGHSAYPHLADNPIPRLLDILRRLTEAPLDEGTPHFQASTLALTTVD
VGNPATNVIPAEARAGFNIRFNDLHSGASLERWIRDTVAQAGGEVEIKVEVSGESFLTPP
GALSDALAEAAFEVTGLRPELSTSGGTSDARFIKNHCPVVEFGLVGQTMHKSDEHVSVAD
MEALTEIYRRVLVRLAAPS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagctttcgcgatcccgtcccgctggcccaggccctgatccgctgtcccagcgtcacc
ccggaggacgcgggggcgctggacgtgctggccggggcgctggaggagctgggctttgcc
tgccaccacatccgctcggcgaccggcggaccggagatccggaacctctatgcccgcctg
ggcaccgaggcgcccaacctctgcttcgccggccacaccgacgtggtgccgcccggcaag
ggctggacggtggagcccttcgccgccggcatcgaccagggacggctgttcgggcggggc
agcgccgacatgaagggcgccatcgcctgcttcgtggccgccgtggcgcggctgctggag
gacggcgcccccaagggctccctctcgctgctgatcaccggcgacgaggaaggccctgcg
gtggatggcaccgtcaaggtgctggactggctggcggcgcgcggtgaacgcatcgattgc
tgcatcgtcggcgagcccaccaatccccgcaagctgggcgacatgatgaagatcggccgg
cgcggcagcctcaattgccgcctgaccgtgttcggaacccaaggacattcggcctatccc
catctggccgacaatcccattccccggctgctggacatcctgcgccggttgaccgaggcg
ccgctggacgagggcacgccccacttccaggcctcgaccctggcgctgaccacggtggac
gtgggcaaccccgccaccaacgtcattcccgccgaggcccgcgccggcttcaacatccgc
ttcaacgacctgcattccggcgcctcgctggaacgctggatcagggataccgtcgcccag
gccggcggcgaggtggagatcaaggtcgaggtgtcgggggaatccttcctgacgccgccc
ggcgcgctgtcggacgccctggccgaggcggccttcgaggtgacgggacttcggcccgaa
ctgtccacctcgggcggcacctccgatgcccgcttcatcaagaaccactgcccggtggtg
gaattcggactggtcggccagaccatgcacaagtcggacgagcatgtttccgtcgccgac
atggaagcgctgaccgagatctaccgccgcgtcctcgtccggctggcggcgccgtcatga

DBGET integrated database retrieval system