KEGG   Magnetospirillum magneticum: amb3880Help
Entry
amb3880           CDS       T00305                                 

Definition
(GenBank) Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
mag  Magnetospirillum magneticum
Pathway
mag02020  Two-component system
mag02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mag00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    amb3880
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    amb3880
Enzymes [BR:mag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     amb3880
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     amb3880
Two-component system [BR:mag02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   amb3880
Bacterial motility proteins [BR:mag02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    amb3880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: BAE52684
UniProt: Q2W0E1
Position
4288064..4288660
Genome map
AA seq 198 aa AA seqDB search
MKRIDAVAIGCSAGGIAALHDILPGLPADLSVPVIVVCHSGPSVHDLLSSVLRRDCLLPV
TEAEERTPAHPGHVHVAPPDYHLLVEPDGTFSLSAEERINNVRPAIDPLLESAADTWGDG
LLAVLLTGANEDGAAGMAAVKAAGGFCIVQDPTGAVAETMPRAAIAAGGADWIAPLDRIA
FLISSLCQPPPSCQERTS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggatcgacgccgtcgccatcggatgttcggcgggagggatcgccgccctgcac
gatattcttcccggactgcccgccgacctgtcagtgccggtgatcgtcgtctgccattcc
ggcccctcggtccatgacctgctgagttcggtgctgcgccgcgactgcctcctgcccgta
accgaagccgaggagaggacccccgcccatcccggccacgtccacgtggcaccgcccgac
taccatcttctggtagagcccgacggcaccttctcgctgtccgctgaagagcgcatcaac
aatgtccggcccgccatcgatcccctgctggaatcggcggcggacacctggggcgacgga
ttgctggcggtattgctgaccggtgccaacgaggacggcgccgcgggcatggccgcagtc
aaggcggccggtggcttctgcatcgtccaggaccccacgggagccgtggccgaaaccatg
ccgcgcgccgccatcgccgccgggggcgccgactggatcgcgccgctggaccgcatcgcc
ttcctgatctcctcgctctgccagccaccgccctcctgccaggagcgcacctcatga

DBGET integrated database retrieval system