KEGG   Magnetospirillum magneticum: amb3951Help
Entry
amb3951           CDS       T00305                                 

Definition
(GenBank) Succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mag  Magnetospirillum magneticum
Pathway
mag00020  Citrate cycle (TCA cycle)
mag00190  Oxidative phosphorylation
mag00650  Butanoate metabolism
mag01100  Metabolic pathways
mag01110  Biosynthesis of secondary metabolites
mag01120  Microbial metabolism in diverse environments
mag01130  Biosynthesis of antibiotics
mag01200  Carbon metabolism
Module
mag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mag_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    amb3951
   00650 Butanoate metabolism
    amb3951
  Energy metabolism
   00190 Oxidative phosphorylation
    amb3951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Osw5 Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: BAE52755
UniProt: Q2W070
Position
4359755..4360135
Genome map
AA seq 126 aa AA seqDB search
MSLESPVGRARGLGSAKEGAGHWIAQRVTAIFLIPLSLWFAVSVIGLSHADYATFKAWMA
KPGNSSLLLLTVLTVLYHAQLGLQVVIEDYVSCECKKIAALVGSKLIIAFLAVFMTVSIL
KVAIGA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgaatcccctgtcggccgcgcccgcggcctcggttccgccaaggaaggcgcc
ggccactggatcgcccagcgcgtcaccgccatcttcctgatccccctgtcgctgtggttc
gccgtctccgtgatcggcctgtcgcacgcagactacgccaccttcaaggcgtggatggcc
aagcccggcaattcctcgctgctgctgctgaccgtgctgaccgtgctgtaccacgcccag
ctgggcctgcaggtggtgatcgaggactacgtcagctgcgagtgcaagaagatcgcggcc
ctggtcgggtccaagctgatcatcgccttcctcgccgtcttcatgacggtgtcgatcctc
aaagtcgcgattggagcctga

DBGET integrated database retrieval system