KEGG   Microbulbifer agarilyticus: Mag101_06270Help
Entry
Mag101_06270      CDS       T04709                                 

Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
maga  Microbulbifer agarilyticus
Pathway
maga00620  Pyruvate metabolism
maga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mag101_06270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:maga02000]
    Mag101_06270
Enzymes [BR:maga01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Mag101_06270
Transporters [BR:maga02000]
 Other transporters
  Primary active transporters [TC:3]
   Mag101_06270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 RnfC_N HlyD_D23 PTS_EIIA_1 TAL_FSA Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AQQ67283
UniProt: A0A1Q2M3I1
Position
1583461..1585269
Genome map
AA seq 602 aa AA seqDB search
MTEVNSLAKKSPLGITDVVLRDAHQSLFATRLRLDDMLPIAEKLDKVGFWSLESWGGATF
DACIRYLGEDPWERIRELKKAMPNTPQQMLFRGQNILGYRHYADDVVEKFVERAATNGVD
VFRVFDAMNDMRNLKTALAAVKKQGKHAQGTISYTVSPVHNMDMWIDLGRQIEDMGADSI
AIKDMAGLLRPYEGYELVSKLKAAVDIPIHMQCHATTGLSTATALKCVEAGIDNIDTAIS
SMSMTYGHSPTESVVAILEGTDRDTGLDINLLEEIAAYFREVRKKYAKFEGSLRGVDSRI
LVAQVPGGMLTNMENQLREQGAGDRLDEVLEEIPRVRKDLGYIPLVTPTSQIVGTQSVLN
VLTGERYKSISKETAAVLKGEYGATPADVNKELQDKVLEGGEPVTCRPADLIAPELDKLS
AELQQKSSEDDIALTAGDGQIDDVLTYALFPQIGLKFLKNRGNADAFEPVPTGNEGSEVK
NDAGESVYTVSVEGESYTVTVADGGDVTGMVKVGGEAVAAPGAAAAPVAAGSGEPVKAPL
AGNIFKVLVKPGDQVAEGQTIVVLEAMKMETAVSAPRAGSVTGVTVKEGDAVAVGDDLLT
IA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggttaactctttagctaaaaaatccccgcttgggattaccgacgtagtcctg
cgtgacgcccaccaatcgctttttgctacccgcctgcgcttggacgacatgctgccgatt
gcagagaagttggataaggtcgggttctggtctctcgagtcttggggtggtgcgacattc
gatgcgtgtattcgctaccttggtgaagatccttgggagcgtattcgcgaactgaaaaaa
gcgatgcccaatacgccgcagcagatgctgttccgcggccaaaacattcttggttaccgt
cactacgcggacgatgtagtggagaagtttgttgagcgcgcggccaccaacggtgtggac
gtattccgcgtgttcgatgcgatgaatgatatgcgcaacctgaaaactgcactggctgca
gtaaagaagcagggtaaacatgcgcaaggcaccatttcttataccgtaagcccggtccac
aacatggatatgtggatagacctgggtcgccagatcgaggatatgggggcggactccatt
gccattaaagatatggctggcctgttacgcccctatgaaggctatgagctggtaagcaaa
ctgaaagccgcggtggacattccaattcatatgcagtgtcacgcgactaccggcctgtct
actgcgaccgcgctgaagtgcgtggaagcgggcatcgacaatatcgacaccgcgatttcc
tccatgtccatgacttatggccacagccccactgaatcggtggtagcaattctggaaggt
accgatcgcgataccggtctcgacattaacctgcttgaggaaattgcggcgtatttccgt
gaggtgcgcaagaaatacgcgaagttcgaaggctccctgcgtggtgttgactctcgaatt
ctggttgcacaagtacctggcggcatgttgaccaatatggaaaaccagctgcgtgaacag
ggcgccggtgatcgtctggacgaagtgctggaagaaattccgcgtgtacgcaaagacctg
ggttatatcccgctggttaccccaacttcacagatcgttggtacccagtcggtattgaac
gttctgaccggtgaacgttacaaatcaatttccaaagaaaccgctgccgtgctgaaaggc
gaatacggcgcgacgccagcagacgtaaataaagagctgcaagacaaggttctggaaggc
ggtgagccggttacctgccgcccggcggacctgattgcaccggaactggacaaactgtct
gcagaattgcagcaaaaatcctccgaagacgatatcgcactcaccgcaggtgacggtcag
attgatgatgtactgacttacgcactgttcccgcaaatcggcctcaagttcctcaagaac
cgcggcaatgcggacgcatttgagccagttcccactggtaatgaaggctccgaagtgaaa
aacgatgcgggcgaaagtgtttataccgtctctgtggaaggtgagagttacaccgtgacc
gttgccgacggcggcgatgtcaccggaatggtcaaagttggtggcgaagcggttgcagca
cctggcgctgccgccgcaccagttgccgcaggctccggcgagccggtaaaagcaccgctg
gctggcaatatcttcaaggtattggtgaagcctggtgatcaggttgccgaaggccagacc
atcgttgtgctggaagccatgaaaatggaaaccgcagtcagcgcgccccgtgcaggcagc
gtgaccggtgtcaccgtgaaagaaggtgatgccgtggcggtgggtgacgacctgctgacc
atcgcgtaa

DBGET integrated database retrieval system