KEGG   Microbulbifer agarilyticus: Mag101_09175Help
Entry
Mag101_09175      CDS       T04709                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
maga  Microbulbifer agarilyticus
Pathway
maga00360  Phenylalanine metabolism
maga00400  Phenylalanine, tyrosine and tryptophan biosynthesis
maga00790  Folate biosynthesis
maga01100  Metabolic pathways
maga01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:maga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Mag101_09175
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mag101_09175
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mag101_09175
Enzymes [BR:maga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Mag101_09175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AQQ67793
UniProt: A0A1Q2M4Y7
Position
2233343..2234140
Genome map
AA seq 265 aa AA seqDB search
MSSKKPSKYVAREPNAEGFIEYTELEHQTWQRLIERQLQIIPGRACDEYMHGLDLLNLPV
DRIPQLEEVNSVLRRETGWETARVPALIGFETFFRLLSERKFPVATFIRTPEEFDYLQEP
DIFHEIFGHCAMLTNPAFANFTQKYGELGLKASPKERGYLARLYWFTVEFGLLNTKDGLR
IYGGGILSSPKETLYALSDEPVRVPFEAVDTLRTPYRIDIVQPIYYLLNDLQDLQQLTEI
DLMARVREAMAAGLFEPMFPPKEAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaaaagcccagcaagtatgtggcccgtgaacccaatgctgagggtttcatt
gaatacaccgagcttgagcaccaaacatggcagcgcctgatcgaaagacagctgcagatt
atccctggccgcgcctgcgatgagtacatgcatggtctcgacctgctgaacctgcctgtg
gaccgcattccccagctggaagaagtaaatagcgtattgcgtcgcgaaaccggctgggaa
accgcacgggtgcccgccctcattggcttcgaaacctttttccgcctgctctccgagcgc
aaattcccggtggcgacctttatccgcacccccgaagaattcgactacctgcaggagccg
gatatcttccacgaaatcttcggccactgcgccatgctcaccaacccagcgtttgccaac
ttcacgcagaagtacggtgaattgggcctgaaagcgagccccaaagagcgcggctacctg
gcgcgcctgtattggttcaccgtcgaattcggactgttgaacaccaaagacggcctgcgt
atttacggtggcggtatcctgtcgtctccgaaagagacgctctacgccctgagcgatgag
ccagtgcgcgtacctttcgaggcggttgataccctgcgcacaccttaccgcatcgatatt
gtgcagcccatttactacctgctgaacgacctgcaagacctgcaacagctcaccgaaatt
gatttgatggcgcgcgtgcgtgaagccatggcggcgggtctgttcgagccaatgttcccg
cccaaagaagcggcgtaa

DBGET integrated database retrieval system