KEGG   Microbulbifer agarilyticus: Mag101_17275Help
Entry
Mag101_17275      CDS       T04709                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
maga  Microbulbifer agarilyticus
Pathway
maga00071  Fatty acid degradation
maga00072  Synthesis and degradation of ketone bodies
maga00280  Valine, leucine and isoleucine degradation
maga00310  Lysine degradation
maga00362  Benzoate degradation
maga00380  Tryptophan metabolism
maga00620  Pyruvate metabolism
maga00630  Glyoxylate and dicarboxylate metabolism
maga00640  Propanoate metabolism
maga00650  Butanoate metabolism
maga00900  Terpenoid backbone biosynthesis
maga01100  Metabolic pathways
maga01110  Biosynthesis of secondary metabolites
maga01120  Microbial metabolism in diverse environments
maga01130  Biosynthesis of antibiotics
maga01200  Carbon metabolism
maga01212  Fatty acid metabolism
maga02020  Two-component system
Brite
KEGG Orthology (KO) [BR:maga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mag101_17275
   00630 Glyoxylate and dicarboxylate metabolism
    Mag101_17275
   00640 Propanoate metabolism
    Mag101_17275
   00650 Butanoate metabolism
    Mag101_17275
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mag101_17275
   00072 Synthesis and degradation of ketone bodies
    Mag101_17275
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mag101_17275
   00310 Lysine degradation
    Mag101_17275
   00380 Tryptophan metabolism
    Mag101_17275
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mag101_17275
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mag101_17275
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mag101_17275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:maga04147]
    Mag101_17275
Enzymes [BR:maga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mag101_17275
Exosome [BR:maga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mag101_17275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AQQ69186
UniProt: A0A1Q2M929
Position
complement(4138088..4139287)
Genome map
AA seq 399 aa AA seqDB search
MQSANIIDTVRIPRARSHAEKGAYAQVKPVALLAPLFHALQTRNDLDPTIVDDVLLGCST
QSGEQGSNIAKMAAMYAGWPDSVPGASISRFCCSGSDAVNTSAAHVAAGMASVMVAGGVE
HLSRVPMFSDKGPWYTDKEVMRATRFMHMGLSADLIATREGYSRARLDELALQSQQRAAH
ASQAGHFANALIPVTDSDGEPILQADDGIRTTSMEKLSALPESFREFAPLAQKLVGFTYP
GTELDCRHTAGNAPALVDGASLVLLASENACAEYGLKPRAKVRHFASASDEPVQMLTGHL
RATEKLLSATGLKSEDIDLWEINESFAASVLKYQQHFAIDFDKLNVNGGAIAMGHPLGAT
GGILIGMLLDELEKRGLQRGLVAICGGAGVGVATLIERG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcgccaatattatcgacaccgtacggatcccccgtgcccgcagtcacgccgag
aaaggcgcctacgcgcaggtaaaacccgtcgcactactcgcaccgctgtttcacgcactg
caaacgcgcaacgacttagatccgactatcgtcgacgatgtactgctgggttgttccacc
cagagcggtgagcagggttccaatatcgccaagatggccgccatgtacgcgggttggccc
gacagtgtgccgggtgccagcatcagccgcttttgctgttcggggtcggatgccgtgaac
acttccgcagcgcatgtcgctgcaggcatggcatcggtgatggtggccggcggtgtcgag
cacctgagccgggtaccgatgttttccgacaagggtccctggtataccgacaaggaagtg
atgcgggcgacgcgctttatgcacatgggtctgtccgccgacctgatcgctactcgcgaa
ggctacagccgcgcacgactggatgagctcgccctgcaatcccagcagcgcgccgcacac
gcatcgcaggcgggccactttgccaacgcgctgattccggtaaccgatagcgacggcgag
ccgatcctgcaggccgacgacggcatacgcacaaccagtatggaaaaactctccgccctg
ccggaaagtttccgcgaattcgcaccgctcgcgcagaagctcgtcggcttcacctatccc
ggaaccgaacttgactgccggcataccgcgggaaatgccccggcgctggtagacggcgca
tcgctggtattgctcgccagcgaaaatgcctgcgcagaatacggcctcaagccgcgcgcc
aaagttcgccactttgccagtgccagcgatgaaccggtacaaatgctcaccggccacctg
cgcgccaccgaaaagttgttgagcgcgaccgggcttaagtcagaagatatcgacctgtgg
gaaattaacgaatcctttgccgcgagcgtactgaaataccagcagcactttgcaatcgat
tttgacaagctgaacgtcaatggtggcgccatcgctatgggtcacccgctgggtgccacc
ggtgggattctaatcggcatgttgctcgacgagctggagaaaagaggcctgcaacgcggt
ctggttgctatttgtggtggtgccggtgtgggagttgcgacattaattgagagaggctga

DBGET integrated database retrieval system