KEGG   Magnetospirillum sp. ME-1: WV31_01150Help
Entry
WV31_01150        CDS       T04817                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn00230  Purine metabolism
magn00240  Pyrimidine metabolism
magn01100  Metabolic pathways
magn01110  Biosynthesis of secondary metabolites
magn01130  Biosynthesis of antibiotics
Module
magn_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
magn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
magn_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:magn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    WV31_01150
   00240 Pyrimidine metabolism
    WV31_01150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:magn04131]
    WV31_01150
Enzymes [BR:magn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     WV31_01150
Membrane trafficking [BR:magn04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    WV31_01150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ARJ64397
UniProt: A0A1W6CHR8
Position
307795..308217
Genome map
AA seq 140 aa AA seqDB search
MAIERTLSIIKPDATRRNLTGKINARFEEAGLRIVAQKRVQLTKAQAGQFYSVHAERSFF
GELVDFMISGPVVVQVLEGEGAVARNREIMGATNPANAAPGTIRADFAESVEANSVHGSD
SAENAAIEIAFFFSGCEIVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgaacgtaccctgtcgatcatcaagcccgacgccacccgccgcaacctcacc
ggcaagatcaacgcccggttcgaggaagccggcctgcgcatcgtcgcccagaagcgcgtg
cagctgaccaaggcccaggccggtcagttctactcggttcacgccgagcgctcgttcttc
ggcgaactggtcgacttcatgatctccggccccgtcgtggtccaggtcctggaaggtgaa
ggcgccgtcgcccgcaaccgcgagatcatgggcgccaccaacccggccaacgccgcgccc
ggcaccatccgcgccgacttcgccgaatcggtggaagccaattcggtgcacggctccgat
tcggccgagaacgccgccatcgagatcgccttcttcttctccggctgcgagatcgtcggc
tga

DBGET integrated database retrieval system