KEGG   Magnetospirillum sp. ME-1: WV31_03535Help
Entry
WV31_03535        CDS       T04817                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn00540  Lipopolysaccharide biosynthesis
magn01100  Metabolic pathways
Module
magn_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:magn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    WV31_03535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:magn01005]
    WV31_03535
Enzymes [BR:magn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     WV31_03535
Lipopolysaccharide biosynthesis proteins [BR:magn01005]
 Unusual sugar
  WV31_03535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 KR NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ARJ64812
UniProt: A0A1W6CIV6
Position
811476..812462
Genome map
AA seq 328 aa AA seqDB search
MILVTGGAGFIGSNILAALEERGAGKLVVCDRLRSGTKWQNIAKRELADIVHPEQIFDFL
EANAKHMEMVIHMGAISATTETDADKILANNFSLSLALWKWCALHNVRFIYASSAATYGD
GTVGFDDDGTMEHLARLRPLNAYGWSKHLFDRRVARKVWAGSRKPPQWAGLKFFNVYGPN
EYHKGGQQSVVAQVYPHAEKNAAYQLFKSHNPKYPDGGQLRDFIWVGDVVDVIMWLIENP
KVSGLFNVGTGKARSFLDLANAVYRAVGREPQIKFRDTPIEIRDKYQYFTQAKMERLHRA
GYSKPFTSLEDGVEMYVKRFLAAQDPYR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgtcaccggcggagccggcttcatcggttccaacatcctggcggccctcgag
gagcggggggcgggcaagctggtggtgtgcgaccgcctgcgctcgggcaccaaatggcag
aacatcgccaagcgcgagctggccgacatcgtccatcccgagcagatcttcgacttcctg
gaagccaacgccaagcacatggagatggtgatccacatgggcgccatctcggccaccacc
gagaccgacgccgacaagatcctggccaacaacttctcgctgtcgctggcgctgtggaag
tggtgcgcgctgcacaacgtgcgcttcatttacgcctcgtcggccgccacctatggcgac
ggcacggtgggcttcgacgacgacggcaccatggagcacctggcccgcttgcgccccctc
aacgcctatggctggtccaagcacctgttcgaccgccgggtggcgcgcaaggtgtgggcc
ggctcgcgcaagccgccgcaatgggcgggcctcaagttcttcaacgtctacggccccaac
gagtaccacaagggcggccagcagagcgtggtggcccaggtctatccccatgccgagaag
aacgccgcctatcagctgttcaagtcccacaatcccaaatacccggacggcggccagctg
cgcgacttcatctgggtgggcgacgtggtggacgtgatcatgtggctgatcgagaacccc
aaggtcagcggcctgttcaacgtgggcaccggaaaggcgcgctcgttcctcgatctggcg
aacgccgtctaccgcgccgtgggccgcgagccgcagatcaagttccgcgacacccccatc
gagatcagggacaagtaccagtacttcacccaggccaagatggagcgcctgcaccgcgcc
ggctattccaagccattcacctcgctggaggacggcgtcgagatgtatgtgaagcgcttc
ctcgccgcccaggacccttaccgctga

DBGET integrated database retrieval system