KEGG   Magnetospirillum sp. ME-1: WV31_06285Help
Entry
WV31_06285        CDS       T04817                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn00071  Fatty acid degradation
magn00072  Synthesis and degradation of ketone bodies
magn00280  Valine, leucine and isoleucine degradation
magn00310  Lysine degradation
magn00362  Benzoate degradation
magn00380  Tryptophan metabolism
magn00620  Pyruvate metabolism
magn00630  Glyoxylate and dicarboxylate metabolism
magn00640  Propanoate metabolism
magn00650  Butanoate metabolism
magn00900  Terpenoid backbone biosynthesis
magn01100  Metabolic pathways
magn01110  Biosynthesis of secondary metabolites
magn01120  Microbial metabolism in diverse environments
magn01130  Biosynthesis of antibiotics
magn01200  Carbon metabolism
magn01212  Fatty acid metabolism
magn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:magn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WV31_06285
   00630 Glyoxylate and dicarboxylate metabolism
    WV31_06285
   00640 Propanoate metabolism
    WV31_06285
   00650 Butanoate metabolism
    WV31_06285
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WV31_06285
   00072 Synthesis and degradation of ketone bodies
    WV31_06285
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WV31_06285
   00310 Lysine degradation
    WV31_06285
   00380 Tryptophan metabolism
    WV31_06285
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WV31_06285
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WV31_06285
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WV31_06285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:magn04147]
    WV31_06285
Enzymes [BR:magn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WV31_06285
Exosome [BR:magn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WV31_06285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARJ65284
UniProt: A0A1W6CKC1
Position
1390929..1392125
Genome map
AA seq 398 aa AA seqDB search
MLDAYIYDGLRSPIGRHAGGLAPVRPDDLAAEVIRALVARSAFKPEDVEDVILGCTNQAG
EDSRNVARHAALLSGLPVEVAGQTVNRLCASGLAAVLDAARSVTCGEGDLFIAGGVESMS
RAPFVLAKAESAWSRDARIFDTTIGARFANPKVVKGFGNHSMPETADNIAHDLGLTREAS
DAFAAASQAKYARAKADGFYEGEIHPITIPGRKGDTVVAEDEHPRPQTDLAALTKLKPLF
EGGVVTAGNASGINDGACSLFIGSRAAGEKAGIKPIARIVAGAAAGVPPRVMGLGPVPAI
TKALARAKLSLKDLDLIEINEAFAVQVLGCVTQLGVAADDSRLNPNGGAIAIGHPLGCSG
ARLALTAARQLQRTGGRYAVVSLCIGVGHGLAAVIERV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcctatatctatgacggcctgcgctcccccattggccgccatgccggcggt
cttgccccggtgcgtcccgacgatctggccgccgaggtgattcgcgccctggtggcccgc
tcggccttcaagccggaagatgtggaggacgtgatcctcggctgcaccaatcaggcgggc
gaggacagccgcaacgtggcccgccacgccgccctgctgtcgggtctgcccgtcgaggtg
gcgggccagaccgtcaaccggctgtgcgcctcgggcttggccgccgtactggacgcggcc
cgctcggtgacctgcggcgagggcgacctgttcatcgccggcggggtggaaagcatgagc
cgcgcccccttcgtgctggccaaggccgaaagcgcctggtcgcgtgacgccaggatcttc
gacaccaccatcggggcgcgcttcgccaatcccaaggtggtgaagggcttcggcaaccat
tccatgcccgagaccgccgacaacatcgcccacgatctgggtctgacgcgcgaagcctcc
gacgccttcgccgccgcctcccaggccaagtacgcgcgtgccaaggccgacgggttctac
gagggcgagattcaccccatcaccataccgggccgcaagggcgacaccgtggtggccgag
gacgagcatccgcgtccccagaccgatctggcggcgctgaccaagctgaagcctctgttc
gagggcggcgtggtcaccgccggcaatgcgtccggcatcaacgacggcgcttgctccctg
ttcatcggctcgcgcgcggcgggcgaaaaggccggtatcaagcccatcgcccgcatcgtc
gccggggcggcggccggcgtgccgccccgcgtcatgggactgggaccggttccggccatc
accaaggccctggcgcgggccaagctgtcgctcaaggacctcgacctcatcgagatcaac
gaggccttcgccgtgcaggtgctgggctgcgtcacccaactgggcgtggccgccgacgat
tcgcggctcaaccccaatggcggggccattgccatcggtcatccgctgggctgctccggc
gcccgtctggcgctcaccgccgcccggcaattgcagcggaccggcgggcgctacgccgtg
gtgtctttgtgcatcggcgtcggccatgggctggccgccgtgatcgagagggtctaa

DBGET integrated database retrieval system