KEGG   Magnetospirillum sp. ME-1: WV31_08585Help
Entry
WV31_08585        CDS       T04817                                 

Definition
(GenBank) 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase
  KO
K07538  6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase [EC:1.1.1.368]
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn00362  Benzoate degradation
magn01100  Metabolic pathways
magn01120  Microbial metabolism in diverse environments
magn01220  Degradation of aromatic compounds
Module
magn_M00541  Benzoyl-CoA degradation, benzoyl-CoA => 3-hydroxypimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:magn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WV31_08585
Enzymes [BR:magn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.368  6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase
     WV31_08585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N UDPG_MGDP_dh_N AdoHcyase_NAD adh_short Methyltransf_25 MoCF_biosynth 2-Hacid_dh_C 3HCDH_N TPP_enzyme_M Methyltransf_11 DegT_DnrJ_EryC1 ApbA
Motif
Other DBs
NCBI-ProteinID: ARJ65706
UniProt: A0A1W6CLK5
Position
1872155..1873231
Genome map
AA seq 358 aa AA seqDB search
MSKSAYRWMMTGVGQPMVKEAMELAAPGAGEVLVEIAGCGVCHTDMDYYYNGVRTNHALP
LALGHEISGRVINTGAGAEGWAGKAVIISAVIPCGECDLCKRGKGTICRSQKMPGNDLQG
GFATHITVPANGLCEVDEARLKAAGLELSEVSVVADALTTPYQAAVQAGIGQGDLVIVIG
CGGVGGYSVQVASAMGAKVVALDIDPAKLEAVKAAGATLGLNPKDFASTRDLKKEIGAFA
KAQGLRSTEWIIMECSGSVPGQQTAFDLMVHGCTICVVGYTMNKAEFRLSNLMAFHARAL
GNWGCGPDLYPGALELVLSGKVNIKNFVERRPLDSINDTFAAVHDHKLSRRAVLCPNA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtccgcttatcgttggatgatgaccggcgtcggccagcccatggtcaaggag
gcgatggaactcgccgccccgggcgccggcgaggttctggtggagatcgccggctgcggc
gtctgccataccgacatggactactattacaatggcgttcgcaccaaccatgccttgccg
ctggcgctgggccacgagatttcgggccgcgtgatcaataccggcgcgggtgcggaaggc
tgggccggcaaggccgtgatcatctccgccgtcatcccctgcggcgagtgcgatctgtgc
aagcgcggcaagggcaccatctgccgctcgcagaagatgccgggcaacgacctgcagggc
ggcttcgccacccacatcaccgttcccgccaacggcctgtgcgaggtcgacgaggcccgc
ctgaaggccgccggccttgagctctcggaagtctccgtggtcgccgacgcgctgaccact
ccctatcaggcggcggtccaggccggcatcggccagggcgatctggtgatcgtcatcggc
tgcggcggcgtgggcggttattccgtccaggtggcctcggccatgggcgccaaggtggtg
gctctcgacatcgaccccgccaagctggaagcggtcaaggcggccggcgcgaccctgggg
ctcaaccccaaggacttcgccagcacccgcgatctcaagaaggagatcggcgccttcgcc
aaggcccagggcctgcgctccaccgagtggatcatcatggaatgctccggctcggttccc
ggccagcagaccgccttcgacctgatggtccacggctgcaccatctgcgtggtgggctac
accatgaacaaggcggagttccgcctgtcgaacctgatggccttccacgcccgcgccctg
ggcaactggggctgcggccccgacctgtatccgggcgcgctcgagctggtgctgtcgggc
aaggtcaacatcaagaacttcgtcgagcgccgtccgctggacagcatcaacgacactttc
gccgccgtgcacgaccacaagctgtcgcgccgcgccgtgctgtgccccaacgcctaa

DBGET integrated database retrieval system