KEGG   Magnetospirillum sp. ME-1: WV31_11540Help
Entry
WV31_11540        CDS       T04817                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn00230  Purine metabolism
magn01100  Metabolic pathways
magn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:magn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    WV31_11540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:magn01002]
    WV31_11540
Enzymes [BR:magn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     WV31_11540
Peptidases and inhibitors [BR:magn01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   WV31_11540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept Phage_TAC_11
Motif
Other DBs
NCBI-ProteinID: ARJ66244
UniProt: A0A1W6CN29
Position
2488547..2490142
Genome map
AA seq 531 aa AA seqDB search
MLHSPMARRGMVTSPHHLASQAGLAVLREGGTAIEAAIATAATLGVVYPHMTGLGGDAFW
LIAEPGKPPVSIDGSGAAGAKVDAELYRKAGHKRIPTRGPLAANTVAGAVSSWQLALDVS
GHWGGRLPLRRLFEDAVFAAREGFAVSRHQAAATQRGLAELKRHPGFAETFLVRRKVPAA
GSVLRLPALADTLERLANAGLDDFYRGEVARAVSAGLQAAGSPLRAEDLARHRGMRRRPL
SLNLPCGHLFNTAPPTQGLASLILLGLYQRLEVTEADGFDHIHGLVEAAKLAYRIRDAHV
TDPARMSIHATTYLEDGVLDRMAWEIDKAKASPSPGAGGEGDTVWLGVIDGQGRAVSFIQ
SLYHAFGSGVVLPEIGVVWQNRGCSFSLDPDHRNALEPRRRPFHTLSPGLARLKDGRTLV
YGTMGGDSQPLVQAEIFTRVALYGQGLQQAVSAPRWCLARALDGAPPPAGIQVEGRIPAE
VLGQLAKAGHHIHVVDEWDSLLGHAGALMRRPDGLIEGAADPRADGVVAAF
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctgcattcgcccatggcccgccggggcatggtgacttccccccaccacctcgcctcc
caggcggggctggccgtgctgcgcgaaggcggcaccgccatcgaggcggccatcgccacc
gccgccacgctgggtgtggtctatccccacatgaccgggctgggcggcgacgccttctgg
ctgatcgccgaaccgggcaagccgcccgtttccatcgacggttcgggcgccgccggggcc
aaggtggatgccgagctctatcgcaaggccggtcacaagcgcattcccacgcgcgggccg
ctggccgccaataccgtggccggcgcggtgtccagctggcagctggcgctggacgtctcg
ggccattggggcgggcgtctgcccttgcgccggctgttcgaggacgcggtgttcgcggcg
cgtgaaggcttcgccgtgtcgcgccatcaggccgcggccacccagcgcgggctggccgaa
ttgaagcgccatcccggcttcgccgagaccttcctggtcaggcgcaaggttcccgccgcc
ggttcggtgctgcgcctgcccgccctggccgacacgctggagcgcctggccaatgccggg
ctcgacgatttctatcgcggcgaggtggcccgcgccgtttccgccggactgcaggccgcc
ggatcacccttgcgcgccgaggatctggcgcgtcatcgcggcatgcgccgccggcctttg
tcgctcaacctgccgtgcgggcatctgttcaataccgcgccgcccacccaaggactggcc
tcgctgatcctgctgggcctgtaccagcgcctggaagtcaccgaggcggacggcttcgac
catatccacggactggtagaggcggccaagctggcctatcgcatcagagacgcccacgtc
accgatccggcgcgcatgtccatccacgccaccacctatctggaggacggcgttctcgac
cgcatggcctgggagatcgacaaggccaaggccagcccgtcgcccggcgcaggcggagag
ggcgacaccgtgtggctcggcgtgatcgacggccagggccgcgccgtcagcttcatccag
agcctgtaccacgccttcggctcgggcgtggtgctgcccgagatcggggtggtctggcag
aaccggggctgttcgttcagcctggacccggaccatcgcaacgcgctggaaccccggcgg
cgtcccttccacaccctgtcgcccggactggcgcgcctcaaggatggccggaccctggtc
tacggcaccatgggcggcgattcccagccgctggtccaggccgagatctttacccgcgtg
gcgctgtacggccagggcctgcagcaggcggtgtcggcgccgcgctggtgcctggcccgc
gccctggacggtgcgccgccgcccgccggcatccaggtggaagggcgcatccctgccgaa
gtgctgggacaactggcgaaagccggtcaccatatccatgtggtggacgagtgggattcg
ctgctggggcacgccggggcgctgatgcggcggcccgacgggctcatcgagggagccgcc
gacccccgtgccgatggcgtggtggcggcgttttaa

DBGET integrated database retrieval system