KEGG   Magnetospirillum sp. ME-1: WV31_16945Help
Entry
WV31_16945        CDS       T04817                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn00480  Glutathione metabolism
magn00590  Arachidonic acid metabolism
magn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:magn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    WV31_16945
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    WV31_16945
Enzymes [BR:magn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     WV31_16945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ARJ67231
UniProt: A0A1W6CQV1
Position
complement(3658281..3658874)
Genome map
AA seq 197 aa AA seqDB search
MHRFIPANPLGSIMASMIAALGLTGAAMAGAAQDRLDWAALSLPAISGGQVEAQSLKGKV
VLVVNTASQCGFTPQYQGLEALWRDYRGRGLVVLGVPSNDFGSQEPGSNAQVASFCEINY
GVDFPLLEKQAVTGANAHPFYRWAAERTGPLGVPRWNFHKILVGRDGRLVDWFASTTAPD
AARLRAAIDKALAEPSS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtttcattcccgccaacccgcttggttccatcatggcttccatgatcgcggcc
ctcggcctgaccggggcggcaatggccggggcggcgcaagaccgcctcgactgggccgcc
ctttccctgccggccatttccggcgggcaggtggaggcccagtccctgaagggcaaggtg
gtgctggtggtcaacaccgcgtcccaatgcggtttcacgccgcaataccaggggctcgag
gccctgtggcgggactatcgcggccgggggctggtggtcctgggggtgccgtccaacgat
ttcggatcgcaggagcccggatccaacgcccaggtggccagcttctgcgagatcaattac
ggcgtcgacttccccctgctggaaaaacaggcggtgaccggcgcgaacgcccacccgttc
taccgctgggcggcggaacgcaccgggccgctgggcgtgccgcgctggaacttccacaag
atcctggtgggccgcgacgggcgtctggtggactggttcgccagcaccaccgcccccgat
gccgcccggctgcgcgccgccatcgacaaggcgctggccgagcctagctcatga

DBGET integrated database retrieval system