KEGG   Magnetospirillum sp. ME-1: WV31_17505Help
Entry
WV31_17505        CDS       T04817                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn00670  One carbon pool by folate
magn00790  Folate biosynthesis
magn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:magn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WV31_17505
   00670 One carbon pool by folate
    WV31_17505
Enzymes [BR:magn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     WV31_17505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ARJ67332
UniProt: A0A1W6CR49
Position
complement(3797725..3798219)
Genome map
AA seq 164 aa AA seqDB search
MTIANIALIVAVAANGVIGKDNRLPWHIPEDLKWFKENTLGKPVIMGRKTWDSIGRPLPK
RPNIVVTRQAGWRAEGAHTAHSLDEALGLAAGLAPEAAELMVIGGNALFAEALPRAGRLY
LTEIGRAYEGDTVFPPLDRSLWREITRRSNAGDPAFDFVILERG
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgcaaatatcgccctgatcgtcgcggtcgccgccaacggcgtgatcggcaag
gataaccggctgccctggcacatccccgaggacctgaagtggttcaaggagaacaccctg
ggcaagccggtgatcatgggccgcaagacctgggactccatcggccgccctctgcccaag
cgccccaacatcgtggtgacgcgccaggccggctggcgggccgagggcgcgcataccgcc
cattccctggacgaggcgctgggcctggcggcgggtctggcccccgaggcggccgaactg
atggtgatcggcggcaacgccctgttcgccgaggccctgccccgggccggacgcctgtat
ctgaccgagatcgggcgcgcctatgagggcgacacggttttccctccgctggaccgctcc
ctttggcgggaaatcacgcggcgttccaatgccggcgaccccgccttcgacttcgtgatt
ctggaacggggctga

DBGET integrated database retrieval system