KEGG   Magnetospira sp. QH-2: MGMAQ_2135Help
Entry
MGMAQ_2135        CDS       T03795                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase with thiolase domain (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
magq  Magnetospira sp. QH-2
Pathway
magq00640  Propanoate metabolism
magq00650  Butanoate metabolism
magq00900  Terpenoid backbone biosynthesis
magq01100  Metabolic pathways
magq01110  Biosynthesis of secondary metabolites
magq01120  Microbial metabolism in diverse environments
magq01130  Biosynthesis of antibiotics
magq01200  Carbon metabolism
magq01212  Fatty acid metabolism
magq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:magq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGMAQ_2135 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    MGMAQ_2135 (phbA)
   00640 Propanoate metabolism
    MGMAQ_2135 (phbA)
   00650 Butanoate metabolism
    MGMAQ_2135 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MGMAQ_2135 (phbA)
   00072 Synthesis and degradation of ketone bodies
    MGMAQ_2135 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGMAQ_2135 (phbA)
   00310 Lysine degradation
    MGMAQ_2135 (phbA)
   00380 Tryptophan metabolism
    MGMAQ_2135 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGMAQ_2135 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGMAQ_2135 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MGMAQ_2135 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:magq04147]
    MGMAQ_2135 (phbA)
Enzymes [BR:magq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGMAQ_2135 (phbA)
Exosome [BR:magq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGMAQ_2135 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF1686
Motif
Other DBs
NCBI-ProteinID: CCQ74027
UniProt: W6KK77
Position
complement(2168304..2169485)
Genome map
AA seq 393 aa AA seqDB search
MTQSVVFLSGVRTAIGDFGGGLRDVEATKLASTVVAESVKRAGVSADLVDHCVIGNVIHS
EPRDMYISRVACIDGGLPQSCPALTLNRLCGSGMQAIVSASQMIMLGDATMAVAGGAENM
SRSGYTLQTNRWGAKMGDSKMIDMMVGALSDPFGAGHMGITAENVANRYGVSREEQDAFA
AESHRRAIAAQAAGHFDSQIVDVEVKQRKKVVIVNKDEHPRGDVTAESLSGLRAAFDREG
SVTAGNASSLNDGAAAVVVASEEAASKAGATPIARLVGYGFSGVQPDEMGIGPVTAVQQA
LAKTGMKLDDMDVVESNEAFAAQACAVGNKLGFDAAKTNPNGGAVALGHPIGATGAIITV
KLIYELQRTGGRYGLATMCIGGGQGIAMIIERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatcagtagtttttttgagtggcgtgcgaacggccatcggcgatttcggcggt
ggattgcgtgatgtggaagcgaccaaactggcctcgacggtggttgccgagtcggtgaaa
cgggccggagtgtcggcggatctggtcgatcattgcgtgatcggcaacgtcatccatagc
gaaccccgtgacatgtatatctcccgcgtggcctgcattgacggcggtctgccgcaaagc
tgtccggcgctcacgctcaatcgcctgtgtggcagcggcatgcaggccatcgtatcagcc
tcgcagatgatcatgttgggggatgccaccatggccgtggccggtggcgccgagaacatg
tcccgctcgggttataccctgcagaccaatcgctggggcgccaaaatgggcgatagcaaa
atgatcgacatgatggtcggtgccctttcggatccgttcggtgcgggacatatgggcatc
acggcggaaaacgtcgccaaccgctatggggtcagccgcgaagagcaagacgctttcgcc
gccgaaagccatcgccgggccatcgccgcccaggccgccggccatttcgatagccaaatc
gtcgatgtggaggtcaagcaacgcaagaaggtggtgatcgtcaataaggacgaacatccg
cgaggcgatgtgaccgccgaatccctgtctggcttgcgcgccgcttttgatcgcgaaggc
agcgtcacggcggggaatgcctcgagcctcaacgatggtgccgccgccgtggtggtggcc
agcgaggaagcggcatccaaggccggcgcaacaccgatcgcccgactggtgggatatggc
ttttcgggtgtgcagcccgatgaaatgggcattggtccggtgactgcggttcagcaagcc
ctggccaagaccggcatgaagcttgacgacatggacgtggtcgaatccaacgaggccttt
gccgcccaggcctgtgccgtgggcaacaagctgggcttcgatgcggccaaaaccaatcca
aacggcggcgctgttgccttgggtcaccccatcggtgccaccggcgccatcattaccgtc
aagctgatctatgaattgcagcgcaccggcggtcgctatgggctcgccaccatgtgcatc
ggcggcggccaaggcatcgccatgatcatcgaacgcctgtaa

DBGET integrated database retrieval system