KEGG   Magnetospira sp. QH-2: MGMAQ_2990Help
Entry
MGMAQ_2990        CDS       T03795                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
magq  Magnetospira sp. QH-2
Pathway
magq00071  Fatty acid degradation
magq00072  Synthesis and degradation of ketone bodies
magq00280  Valine, leucine and isoleucine degradation
magq00310  Lysine degradation
magq00362  Benzoate degradation
magq00380  Tryptophan metabolism
magq00620  Pyruvate metabolism
magq00630  Glyoxylate and dicarboxylate metabolism
magq00640  Propanoate metabolism
magq00650  Butanoate metabolism
magq00900  Terpenoid backbone biosynthesis
magq01100  Metabolic pathways
magq01110  Biosynthesis of secondary metabolites
magq01120  Microbial metabolism in diverse environments
magq01130  Biosynthesis of antibiotics
magq01200  Carbon metabolism
magq01212  Fatty acid metabolism
magq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:magq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGMAQ_2990 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    MGMAQ_2990 (phbA)
   00640 Propanoate metabolism
    MGMAQ_2990 (phbA)
   00650 Butanoate metabolism
    MGMAQ_2990 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MGMAQ_2990 (phbA)
   00072 Synthesis and degradation of ketone bodies
    MGMAQ_2990 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGMAQ_2990 (phbA)
   00310 Lysine degradation
    MGMAQ_2990 (phbA)
   00380 Tryptophan metabolism
    MGMAQ_2990 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGMAQ_2990 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGMAQ_2990 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MGMAQ_2990 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:magq04147]
    MGMAQ_2990 (phbA)
Enzymes [BR:magq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGMAQ_2990 (phbA)
Exosome [BR:magq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGMAQ_2990 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C CMD
Motif
Other DBs
NCBI-ProteinID: CCQ74830
UniProt: W6KBF7
Position
complement(3014832..3016007)
Genome map
AA seq 391 aa AA seqDB search
MSEIVIAGAARTPIGAFSGSLSTLAAHELGEIVVTEALKRAKVSPEEVSEVILGQVLTAG
TGQNPARQTAIAAGIPHGSTAYTINQVCGSGLRAVALGLQAIRNGDSSVVVAGGQESMSL
SAHCVHLRTGTKMGNTDLVDTMIKDGLWDAFNGYHMGTTAENVATKWGLTRDEQDAFAVA
SQNKAEAAQKAGKFDEEIVPVTIKTRKGETVVDKDEYIRHGATIEGMAKLRPAFSKDGTV
TAGNASGINDGASVCVLMTAEEAAKRGVEPLARIVSWATVGVDPAIMGSGPIPASQAALE
KAGWTADDLDLVEANEAFAAQACAVNKDMGWDLDKVNVNGGAIALGHPIGASGNRVLVTL
LHEMKRRDAKKGLATLCIGGGMGIAMCVARD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagattgttatcgccggtgccgctcgtacacccattggggccttcagcggcagc
ctcagcacccttgccgctcatgagttgggcgaaatcgtcgtaaccgaggccctgaaacgg
gcgaaggtctctcccgaagaggtttccgaggtcatcctgggtcaggtcctgaccgccggc
acgggccagaacccggctcgccagaccgctatcgcggccggtattccgcacggcagcacg
gcctataccatcaaccaggtgtgtggctccggcctgcgcgccgtggccttgggcctgcaa
gcgattcgcaatggagacagctctgttgtcgtcgccggtggccaggaaagcatgagtctg
tcggcccattgtgtgcatctgcgcacgggcaccaagatgggcaataccgatctggtggac
accatgatcaaggacggtctgtgggatgccttcaacggctatcacatgggaaccacggcc
gagaacgtggccaccaagtggggcctgacccgcgacgaacaggacgcctttgccgttgcc
tcgcaaaacaaagccgaagcggctcaaaaagcgggcaagttcgacgaggaaatcgtgccg
gtaaccatcaagacccgcaagggcgaaacggtggtcgacaaggatgaatacatccgccat
ggcgccaccatcgaaggcatggccaaactgcgtccggccttctccaaggacggtaccgtg
accgccggcaatgcctcgggcatcaatgatggcgcttcggtctgtgtgctgatgaccgcc
gaggaagccgccaagcgcggcgtggaaccgctggctcgcatcgtctcgtgggccaccgtc
ggcgtggatccggcgatcatgggctccgggccgatcccggccagccaggcggctttggaa
aaggccggttggactgccgacgatttggacctggttgaagccaacgaagccttcgccgcg
caggcctgtgccgtcaacaaggacatgggctgggacctggacaaggtgaatgtcaacggt
ggcgccatcgccctgggtcatcccatcggtgcctcgggcaaccgggtcctggtcaccttg
ctgcacgagatgaagcgacgcgacgccaagaagggtctggcgaccctatgcatcggtggc
ggcatgggtatcgccatgtgcgtggcccgcgactaa

DBGET integrated database retrieval system