KEGG   Magnetospirillum sp. XM-1: XM1_0212Help
Entry
XM1_0212          CDS       T04231                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
magx  Magnetospirillum sp. XM-1
Pathway
magx00020  Citrate cycle (TCA cycle)
magx00480  Glutathione metabolism
magx01100  Metabolic pathways
magx01110  Biosynthesis of secondary metabolites
magx01120  Microbial metabolism in diverse environments
magx01130  Biosynthesis of antibiotics
magx01200  Carbon metabolism
magx01210  2-Oxocarboxylic acid metabolism
magx01230  Biosynthesis of amino acids
Module
magx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
magx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:magx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XM1_0212 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XM1_0212 (icd)
Enzymes [BR:magx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     XM1_0212 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: CUW37281
UniProt: A0A0U5MWU1
Position
I:complement(198109..199326)
Genome map
AA seq 405 aa AA seqDB search
MKKIKVANPIVELDGDEMTRIIWKFIKDKLILPYLDVDLKYYDLGIEYRDKTDDKVTIEA
SEAIKKYGVGVKCATITPDEARVKEFNLKKMWKSPNGTIRNILDGTVFREPIICKNVPRL
VPGWTKPIVIGRHAFGDQYKATDFTVPGPGKLTIKFVGTNGETIEHEVFDFPGAGVAMGM
YNLDESIYGFARACMNYGLQKKWPVYLSTKNTILKAYDGRFKDIFQEVFDKEFKVEFDKL
GITYEHRLIDDMVASALKWSGEFVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMSPDGKV
VEAEAAHGTVTRHYREHQKGKETSTNPIASIFAWTRGLFYRAQFDNTPEVAKFAQSLEEV
CVETVESGFMTKDLAILIGPGQSWLTTQQFLDKLDENLKKRMGLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatcaaagtcgcaaacccgatcgtcgagctggacggcgacgagatgacccgg
atcatctggaagttcatcaaggacaagctgatcctgccctacctggacgtggatctgaaa
tattacgatctgggcatcgaataccgcgacaagaccgacgacaaggtgacgatcgaggcc
tcggaggccatcaagaagtacggcgtcggcgtcaagtgcgccaccatcacccccgacgag
gcgcgggtgaaggaattcaacctgaagaagatgtggaagtcgcccaacggcaccatccgc
aacattcttgacggcaccgtgttccgcgagccgatcatctgcaagaacgtgccgcgcctg
gtgcccggctggaccaagcccatcgtcatcggccgccacgccttcggcgaccaatacaag
gccaccgacttcaccgtccccggccccggcaagctgaccatcaagttcgtcggcaccaac
ggcgagaccatcgagcacgaagtgttcgacttccccggcgccggcgtggccatgggcatg
tacaacctggacgagtccatctacggcttcgcccgggcctgcatgaattacggcctgcag
aagaagtggccggtgtacctgtcgaccaagaacaccatcctcaaggcctatgacggccgc
ttcaaggacatcttccaggaagtgttcgataaggagttcaaggtcgagttcgacaagctg
ggcatcacctacgagcaccgcctgatcgacgacatggtggcgtccgccttgaagtggtcg
ggcgagttcgtctgggcctgcaagaactacgacggcgacgtgcagtccgacaccgtggcc
cagggcttcggctcactgggcctgatgacctcggtgctgatgagccccgacggcaaggtc
gtcgaggccgaggccgcccacggcacggtgacgcggcactaccgcgagcaccagaagggc
aaggagacctcgaccaatccgatcgcgtcgatcttcgcctggacccgcggcctgttctat
cgcgcccagttcgacaacacccccgaggtggcgaagttcgcccagtccctcgaggaagtg
tgcgtggaaacggtggaatccggcttcatgaccaaggacctggccatcctgatcggcccc
ggccagtcgtggctgaccacccagcagttcctggacaagctggacgagaacctgaagaag
cggatgggtctggcctga

DBGET integrated database retrieval system