KEGG   Magnetospirillum sp. XM-1: XM1_0396Help
Entry
XM1_0396          CDS       T04231                                 

Gene name
apaG
Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
magx  Magnetospirillum sp. XM-1
Brite
KEGG Orthology (KO) [BR:magx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XM1_0396 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CUW37465
UniProt: A0A0U5HV56
Position
I:390868..391260
Genome map
AA seq 130 aa AA seqDB search
MYSQTTRDIEVTVKPFYLDDQSSPGDNHFVWAYRVRIVNKGSRTVQLMRRHWVITDAIGR
VQEVKGPGVVGEQPVLRPGDAYEYTSGTPLPTPSGIMVGTYEMEDEDGSAFDIAIPAFSL
DSPHEKPRLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtacagccagaccacccgggacatcgaggtgaccgtcaagccgttctacctggacgac
cagtcctcgcccggcgacaaccacttcgtctgggcctaccgcgtgcgcatcgtcaacaag
ggctcgcgcaccgtccagctcatgcgccgccactgggtgatcaccgacgccatcggccgg
gtgcaggaggtcaagggccccggcgtggtgggtgaacagccggtgctgcgtcccggcgac
gcctacgaatatacctcgggcacgcccctgcccacgccatcgggcatcatggtcggcacc
tacgagatggaggacgaggacggttcggccttcgacatcgccattcccgccttctcgctg
gacagcccgcacgagaagccccgactgaattag

DBGET integrated database retrieval system