KEGG   Magnetospirillum sp. XM-1: XM1_2006Help
Entry
XM1_2006          CDS       T04231                                 

Gene name
fda
Definition
(GenBank) fructose-1,6-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
magx  Magnetospirillum sp. XM-1
Pathway
magx00010  Glycolysis / Gluconeogenesis
magx00030  Pentose phosphate pathway
magx00051  Fructose and mannose metabolism
magx00680  Methane metabolism
magx00710  Carbon fixation in photosynthetic organisms
magx01100  Metabolic pathways
magx01110  Biosynthesis of secondary metabolites
magx01120  Microbial metabolism in diverse environments
magx01130  Biosynthesis of antibiotics
magx01200  Carbon metabolism
magx01230  Biosynthesis of amino acids
Module
magx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
magx_M00165  Reductive pentose phosphate cycle (Calvin cycle)
magx_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:magx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XM1_2006 (fda)
   00030 Pentose phosphate pathway
    XM1_2006 (fda)
   00051 Fructose and mannose metabolism
    XM1_2006 (fda)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    XM1_2006 (fda)
   00680 Methane metabolism
    XM1_2006 (fda)
Enzymes [BR:magx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     XM1_2006 (fda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CUW39075
UniProt: A0A0U5MDC5
Position
I:complement(2012502..2013566)
Genome map
AA seq 354 aa AA seqDB search
MSLVSMRQLLDHAAENGYGIPAFNVNNMEQVKAIMEAASATDSPVILQASAGARKYAGEP
FLRHLILAAIEAYPQIPVCMHQDHGTSPAVNVRAIQSGFSSVMMDGSLKEDGKTPSDWDY
NVAVTKQVVDIAHACGVSVEGELGCLGSLETGTAGKEDGIGAEGKLDHSQLLTDPDEAAE
FVKATKVDALAIAIGTSHGAYKFTRPPTGEVLAIKRIKEIHARIPNTHLVMHGSSSVPQD
LLKIVNDYGGALGETYGVPVEEIVEGIKHGVRKINIDTDLRLAVTGCIRKYFHDNPKKFD
PRDYLKPSIAAMVEVCKSRYQAFGTAGQASKIKVIGLEDMSALYAKGALAPKVN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcgtttcgatgcgccagctcctcgaccacgcggccgagaacggctacggcatt
cccgccttcaacgtgaacaacatggagcaggtcaaggcgatcatggaggcggcctccgcc
accgattcgccggtcatcctccaggcctcggccggtgcccgcaaatacgccggcgagccc
ttcctgcgccacctgatcctggccgcgatcgaagcctatccgcagatcccggtctgcatg
caccaggaccacggcaccagcccggcggtcaacgtgcgcgccatccagtccggcttctcc
tcggtgatgatggacggctcgctcaaggaagacggcaagaccccgtccgattgggactac
aacgtcgccgtcaccaagcaggtggtcgacatcgcgcatgcctgcggcgtctcggtcgag
ggtgagctgggctgcctgggctcgctggaaaccggcaccgccggcaaggaagacggcatc
ggcgccgagggcaagctggaccattcccagctgctgaccgacccggacgaggccgccgaa
ttcgtcaaggccaccaaggtggacgcgctggccatcgccatcggcaccagccacggcgcc
tacaagttcacccgtccgccgacgggcgaggtgctggccatcaagcgcatcaaggaaatc
cacgcccgcatccccaacacccatctggtgatgcacggctcctcctcggtgccgcaggac
ctcctgaagatcgtcaacgattacggcggcgcgctcggcgagacctacggcgtgccggtc
gaggaaatcgtcgagggcatcaagcacggtgtgcgcaagatcaacatcgacaccgatctg
cgtctggccgtcaccggctgcatccgcaagtacttccacgacaaccccaagaagttcgat
ccccgcgactacctgaagccctccatcgccgccatggtcgaggtctgcaagagccgctac
caggccttcggcaccgccggccaggcatcgaagatcaaggtgatcggcctggaagacatg
agcgcgctgtacgccaagggcgccctggctcccaaggtgaactga

DBGET integrated database retrieval system