KEGG   Magnetospirillum sp. XM-1: XM1_3291Help
Entry
XM1_3291          CDS       T04231                                 

Gene name
nagZ
Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
magx  Magnetospirillum sp. XM-1
Pathway
magx00520  Amino sugar and nucleotide sugar metabolism
magx01100  Metabolic pathways
magx01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:magx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XM1_3291 (nagZ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    XM1_3291 (nagZ)
Enzymes [BR:magx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XM1_3291 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: CUW40352
UniProt: A0A0U5MK91
Position
I:complement(3269422..3270441)
Genome map
AA seq 339 aa AA seqDB search
MPAVNAAIFGCSGLVLTQAERDFFRRVNPLGFILFARNVADPAQVKALVESLRDCVGRAD
APVLIDQEGGRVQRLKPPHWRKAPPGEPFAALAARDLAAAQEALRLNFRLIGAELADLGI
DVDCAPVLDVPIAGAHDVIGDRAYGRTAQSVIDLAGAVIDGLLDEGVLPVIKHIPGHGRA
MVDSHLDLPVVDTPLAELETQDFPPFHAYRHAPWAMTAHVVYTALDAAHPATTSRMVIDK
VIRGAIGFDGLLISDDLSMKALGGTFEDRTRASLEAGCDVVLHCNGDMEEMTAIASELRP
LSAAAEVRVAHGLAQKRKRVPFDRKAAEERVASLLGLSP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgccgttaacgccgccatcttcggctgttccggcctggtcctgacccaggcggag
cgcgacttcttccggcgcgtcaacccgctgggcttcatcctgttcgcccgcaacgtggcg
gatccggcccaggtcaaggcgctggtggagtccttgcgcgattgcgtgggccgcgccgac
gcgccggtgctgatcgaccaggaggggggcagggtgcagcgcctgaagccgccccattgg
cgcaaagcgccgcccggcgagcccttcgccgctctggccgcccgcgatcttgccgccgcc
caggaggctcttcgccttaatttccgcctgatcggggcggaactggccgatctgggcatc
gacgtggattgcgccccggtcctcgatgttcccattgccggcgcccatgacgtcatcggc
gaccgcgcctatggccgcaccgcccagtcggtgatcgatctggccggcgcggtgatcgac
ggcttgctggacgagggcgtgctgccggtgatcaagcacattcccggccacggccgcgcc
atggtggacagccatctcgacctgccggtggtcgatactccgctggccgagctggagacc
caggactttccgcccttccacgcctatcgccacgcgccctgggccatgaccgcccatgtg
gtctacaccgcccttgacgccgcccatcccgccaccacctcaagaatggtgatcgacaag
gtgatccgtggcgccatcggcttcgacggcctgctgatctccgacgatctgtccatgaag
gcgctgggcggtacgttcgaggaccgcacccgcgccagtctggaggcgggctgcgacgtg
gtgcttcactgcaacggcgacatggaagagatgaccgccatcgcgtccgaactgcgcccg
ttgagcgcggcggccgaggtgcgggtggcccatggcctggcgcaaaagcgcaagcgggtt
cccttcgaccgcaaggccgccgaggagcgggtcgcctcgctgcttggcctgtccccatga

DBGET integrated database retrieval system