KEGG   Magnetospirillum sp. XM-1: XM1_3405Help
Entry
XM1_3405          CDS       T04231                                 

Gene name
dcaF
Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
magx  Magnetospirillum sp. XM-1
Pathway
magx00071  Fatty acid degradation
magx00072  Synthesis and degradation of ketone bodies
magx00280  Valine, leucine and isoleucine degradation
magx00310  Lysine degradation
magx00362  Benzoate degradation
magx00380  Tryptophan metabolism
magx00620  Pyruvate metabolism
magx00630  Glyoxylate and dicarboxylate metabolism
magx00640  Propanoate metabolism
magx00650  Butanoate metabolism
magx00900  Terpenoid backbone biosynthesis
magx01100  Metabolic pathways
magx01110  Biosynthesis of secondary metabolites
magx01120  Microbial metabolism in diverse environments
magx01130  Biosynthesis of antibiotics
magx01200  Carbon metabolism
magx01212  Fatty acid metabolism
magx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:magx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XM1_3405 (dcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    XM1_3405 (dcaF)
   00640 Propanoate metabolism
    XM1_3405 (dcaF)
   00650 Butanoate metabolism
    XM1_3405 (dcaF)
  Lipid metabolism
   00071 Fatty acid degradation
    XM1_3405 (dcaF)
   00072 Synthesis and degradation of ketone bodies
    XM1_3405 (dcaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XM1_3405 (dcaF)
   00310 Lysine degradation
    XM1_3405 (dcaF)
   00380 Tryptophan metabolism
    XM1_3405 (dcaF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XM1_3405 (dcaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XM1_3405 (dcaF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XM1_3405 (dcaF)
Enzymes [BR:magx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XM1_3405 (dcaF)
Exosome [BR:magx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XM1_3405 (dcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CUW40466
UniProt: A0A0U5FWB1
Position
I:complement(3394483..3395679)
Genome map
AA seq 398 aa AA seqDB search
MLDAYIYDGLRSPIGRHAGGLAPVRPDDLAAEVIRALVARSSFKPEDVEDVILGCTNQAG
EDSRNVARHAALLSGLPVEVAGQTVNRLCASGLAAVLDAARSVTCNEGDLFIAGGVESMS
RAPFVLAKAESAWSRDAKIFDTTIGARFANPRVIKGFGNHSMPETADNIAHDLNLTREAS
DAFAAASQAKYARAKADGFYEGEIHPITIVGRKGDIVVAEDEHPRPQTDLAALTKLKPLF
EGGVVTAGNASGINDGAAALFIGSRAAGEKAGVAPIARIVAGAAAGVPPRVMGLGPVPAI
TKALARAKLSLKDLDLIEINEAFAVQVLGCVTQLGVAADDSRLNPNGGAIAIGHPLGCSG
ARLALTAARQLQRTGGRYAVVSLCIGVGHGLAAVIERV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcctacatctatgacggcctgcgttctcccatcggccgccatgccggcggc
ctcgccccggtgcgccccgacgatctcgccgccgaggtgattcgcgccctggtggcccgc
tcgtccttcaagccggaagatgtcgaggacgtcatcctcggctgtaccaaccaggcgggt
gaggacagccgcaacgtggcccgccacgccgcgctgttgtccggcctgcccgtcgaggtg
gcgggccagaccgtcaaccggctgtgcgcctcgggcctggcggccgtgctggacgcggct
cgctcggtgacctgcaatgagggcgacctgttcatcgccggcggcgtggaaagcatgagc
cgcgcccccttcgtgctggccaaggccgaaagcgcctggtccagggacgccaagatcttc
gacaccaccatcggggcgcgcttcgccaatcccagggtgatcaagggctttggcaaccat
tccatgcccgagaccgccgacaacatcgcccacgacctgaatctcacgcgtgaggcctcg
gatgccttcgccgccgcctcccaggccaagtatgcgcgcgccaaggccgacggcttctac
gagggcgagatccatcccatcaccatagtgggccgcaagggcgacattgtggtggccgag
gacgagcatccgcgtccccagaccgatctggcggcgctgaccaagctgaagcctctgttc
gagggcggcgtggtcaccgccggcaatgcgtccggcatcaatgacggcgcggcggccctg
ttcatcggctcgcgcgcggcgggcgagaaggcgggtgttgcgcccatcgcccgcatcgtc
gccggtgctgcggccggcgtgccgccccgtgtcatgggcctggggccggttccggccatc
accaaggccctggcgcgggccaagctgtccttgaaggacctcgatctcatcgagatcaac
gaggctttcgccgtgcaggtgctgggctgcgtcacccagctgggcgtggcggccgacgat
tcgcggctcaaccccaatggcggggccatcgccatcggccatccgctgggctgttcgggc
gcccgtctggcgctcaccgccgcccggcagctgcagcggaccggcgggcgctatgccgtg
gtctcgctctgtatcggcgtcggccacgggctggccgccgtgatcgaaagggtctga

DBGET integrated database retrieval system