KEGG   Magnetospirillum sp. XM-1: XM1_4478Help
Entry
XM1_4478          CDS       T04231                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system T-protein gcvT
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
magx  Magnetospirillum sp. XM-1
Pathway
magx00260  Glycine, serine and threonine metabolism
magx00630  Glyoxylate and dicarboxylate metabolism
magx00670  One carbon pool by folate
magx01100  Metabolic pathways
magx01110  Biosynthesis of secondary metabolites
magx01130  Biosynthesis of antibiotics
magx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:magx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XM1_4478 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XM1_4478 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    XM1_4478 (gcvT)
Enzymes [BR:magx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     XM1_4478 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C tRNA_edit
Motif
Other DBs
NCBI-ProteinID: CUW41537
UniProt: A0A0U5N9Z5
Position
I:complement(4516945..4518060)
Genome map
AA seq 371 aa AA seqDB search
MSESDTPLLTVPLDALHRELGAKMVPFAGYAMPVQYPAGVLAEHLHTRSAAALFDVSHMG
QAEIRGPKAVELLETLVPGDIQALGIGKTRYSVFTNDQGGILDDLMISKLADDHLFLVIN
AACKHADFAHLARHLGGKVELRMIEDRSLLALQGPGAAAAMATLCPEAVAMTFMTIAEIK
VAGIPVLATRSGYTGEDGWEMSVANADAEKLARALLAAPGVMPAGLGARDSLRLEAGLCL
YGSDIDTTTTPVQANIAWIMSKRRKAEGGFPGAAVIQKQLAEGAPTLRVGIQPDGKAPAR
AHTEITDEAGNRLGEICSGGFGPSAGGPVAMGYVPAAFAAIGTKLKLVVRGKAMDAHVCA
LPFVPHRYFKG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgagtccgatactcccctgttgactgtccccctggacgccctgcatcgcgagctg
ggggccaagatggtgcccttcgccggctatgccatgccggtgcagtatcccgccggcgtg
ctggccgagcacctgcacacccggtcggcggcggcgctgttcgatgtttcccacatgggg
caggcggaaatccgcgggcccaaggcggtggaactgctggaaaccctggtgcccggcgac
atccaggccctgggaatcggcaagacccgttattcggtgttcaccaacgaccagggcggc
atcctcgacgacctgatgatcagcaagctggccgacgaccacctgttcctggtgatcaac
gccgcctgcaagcacgccgacttcgcccacctcgcccggcatctgggcggcaaggtcgag
cttcgcatgatcgaggaccgctcgctgctggcgctgcaggggcccggcgcggccgccgcc
atggcgaccctgtgccccgaggcggttgccatgaccttcatgaccatcgccgagatcaag
gtggcgggcattcccgtgctggccacccgttcgggctataccggcgaggacggctgggag
atgtcggtggccaatgccgacgcagaaaagctggcccgcgccctgctggccgcgccgggc
gtcatgccggccgggctgggggcgcgcgattcgcttcgcctggaagccggcctgtgtctc
tacggctcggacatcgacaccaccaccacgccggtccaggccaacatcgcctggatcatg
agcaagcgccgcaaggccgaaggcggcttccccggtgccgccgtgatccaaaagcagttg
gccgagggcgcgcccacccttcgggtcggcatccagcccgatggcaaggccccggcccgc
gcccataccgagatcaccgacgaggcgggcaaccggctgggcgaaatctgctccggcggc
ttcggcccgtcggccggcgggccggtggccatgggctatgtccccgccgccttcgccgca
atcgggaccaagctgaagctggtggtgcgcggcaaggccatggacgcccatgtctgtgcc
ctgccgttcgtgccgcatcgttatttcaaaggctga

DBGET integrated database retrieval system